Protein Family IF04627
Metagenome
Isolate
141
Members
78
Samples
126
Scaffolds
311.96
Avg Length
Representative Sequence
- ID
- 3300042591|Ga0466692_040365|Ga0466692_040365_42420_43394
- Length
- 324 aa
- Sequence
- MSDGTMTLSAFSGTRRALICGSLAYDHIMIFQDRFKNHILPEKIHVLNVAFLVPEMRREFGGCAGNIAYGLRLLGETPHVMATVGEDFAPYRERLTRLGLPLARIRQIPGTFTAQAFITTDLDDNQITAFHPGAMSRSHENRIAAGDAELGIVAPDGRDGMLGHARDFSAAGIPFIFDPGQGLPMFSGEELLEFLELAEYACFNDYEINLASERTGLSTERLAERVAALIVTRGGEGSLIYAGGTRLEIPCAPARALVDPTGCGDAYRAGLLYGLLHEFDWRKAGQLASLMGALKIEHPGPQNYAPSREEIAARYAEAFGDRLF
Sample Types
Isolate
10.6%
Metagenome
89.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Formicidae
18.9%
Termitidae
17.6%
Kalotermitidae
16.2%
Unclassified
12.2%
Armadillidiidae
9.5%
Culicidae
8.1%
Elmidae
4.1%
Rhinotermitidae
4.1%
Hydrophilidae
2.7%
Passalidae
1.4%
Hodotermitidae
1.4%
Curculionidae
1.4%
Cixiidae
1.4%
Termopsidae
1.4%
Taxonomy
Archaea
0
Bacteria
124
Eukaryota
0
Viruses
0
Unclassified
17
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2864755708 | Massilia timonae S00006 | Isolate | Elmidae |
| 2 | 2864761044 | Stenotrophomonas rhizophilia S00008 | Isolate | Elmidae |
| 3 | 2820084079 | Unclassified Proteobacteria Lab288P4bin103 | Isolate | Unclassified |
| 4 | 3300006995 | Ant gut microbial communities from Cephalotes angustus, Brazil | Metagenome | Formicidae |
| 5 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 6 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 7 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 8 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 9 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 10 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 11 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 12 | 2864826666 | Acidovorax konjaci S00067 | Isolate | Elmidae |
| 13 | 2873562573 | Thermomonas sp. HDW16 | Isolate | Hydrophilidae |
| 14 | 2873571580 | Diaphorobacter sp. HDW4B | Isolate | Hydrophilidae |
| 15 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 16 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 17 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 18 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 19 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 20 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 21 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 22 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 23 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 24 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 25 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 26 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 27 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 28 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 29 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 30 | 2891720358 | Azoarcus nasutitermitis CC-YHH838 | Isolate | Unclassified |
| 31 | 2820086750 | Unclassified Proteobacteria Lab288P3bin98 | Isolate | Unclassified |
| 32 | 2820132692 | Unclassified Proteobacteria Emb289P3bin76 | Isolate | Unclassified |
| 33 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 34 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 35 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 36 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 37 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 38 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 39 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 40 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 41 | 2648501628 | Xanthomonas sp. Cag60 | Isolate | Unclassified |
| 42 | 2820103659 | Unclassified Proteobacteria Emb289P4bin67 | Isolate | Unclassified |
| 43 | 2820123897 | Unclassified Proteobacteria Emb289P4bin18 | Isolate | Unclassified |
| 44 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 45 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 46 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 47 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 48 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 49 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 50 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 51 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 52 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 53 | 2548876789 | Xanthomonas sacchari NCPPB 4393 | Isolate | |
| 54 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 55 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 56 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 57 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 58 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 59 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 60 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 61 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 62 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 63 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 64 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 65 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 66 | 2617270844 | Dyella sp. HyOG | Isolate | Cixiidae |
| 67 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 68 | 3300012815 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG | Metagenome | |
| 69 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 70 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 71 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 72 | 2820152154 | Unclassified Proteobacteria Cu122P5bin47 | Isolate | Unclassified |
| 73 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 74 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 75 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 76 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 77 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 78 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466726_014918 | 3300042619 | Bacteria | 10030 |
| 2 | Ga0160444_100359 | 3300012841 | Unclassified | 25920 |
| 3 | Ga0160447_101032 | 3300012849 | Bacteria | 11451 |
| 4 | Ga0466657_295952 | 3300042582 | Bacteria | 1562 |
| 5 | Ga0466696_036315 | 3300042596 | Bacteria | 3248 |
| 6 | Ga0466719_230524 | 3300042606 | Bacteria | 6931 |
| 7 | Ga0466722_095194 | 3300042609 | Bacteria | 5497 |
| 8 | Ga0466722_239428 | 3300042609 | Bacteria | 6395 |
| 9 | Ga0102737_1013918 | 3300007142 | Bacteria | 1298 |
| 10 | Ga0103267_1022387 | 3300007190 | Unclassified | 2086 |
| 11 | Ga0123357_10000005 | 3300009784 | Bacteria | 295874 |
| 12 | Ga0466734_087084 | 3300042623 | Bacteria | 7581 |
| 13 | Ga0466704_356148 | 3300042643 | Bacteria | 3475 |
| 14 | Ga0466708_383670 | 3300042652 | Bacteria | 15465 |
| 15 | Ga0466723_354157 | 3300042618 | Bacteria | 25046 |
| 16 | Ga0160430_104108 | 3300012852 | Bacteria | 3752 |
| 17 | Ga0160436_1000360 | 3300012861 | Bacteria | 19354 |
| 18 | Ga0160436_1003510 | 3300012861 | Bacteria | 3837 |
| 19 | Ga0123355_10025730 | 3300009826 | Bacteria | 9477 |
| 20 | Ga0466701_043591 | 3300042598 | Bacteria | 136062 |
| 21 | Ga0466719_142743 | 3300042606 | Bacteria | 4041 |
| 22 | Ga0466722_253205 | 3300042609 | Bacteria | 2894 |
| 23 | Ga0102736_1000989 | 3300007052 | Bacteria | 5222 |
| 24 | Ga0466730_100685 | 3300042625 | Unclassified | 16698 |
| 25 | Ga0466709_159721 | 3300042648 | Bacteria | 3831 |
| 26 | Ga0466725_394147 | 3300042654 | Bacteria | 8471 |
| 27 | Ga0466728_140742 | 3300042620 | Bacteria | 2481 |
| 28 | Ga0160443_100003 | 3300012848 | Bacteria | 802970 |
| 29 | Ga0160434_101384 | 3300012850 | Unclassified | 4553 |
| 30 | Ga0466692_071110 | 3300042591 | Bacteria | 106079 |
| 31 | Ga0466696_347002 | 3300042596 | Bacteria | 2356 |
| 32 | Ga0123356_10041422 | 3300010049 | Bacteria | 4291 |
| 33 | Ga0123356_10521587 | 3300010049 | Unclassified | 1346 |
| 34 | Ga0466716_167190 | 3300042605 | Bacteria | 2608 |
| 35 | Ga0466719_034517 | 3300042606 | Bacteria | 2018 |
| 36 | CVPL005L_10019516 | 3300002938 | Bacteria | 3595 |
| 37 | Ga0102733_101174 | 3300006995 | Bacteria | 1600 |
| 38 | Ga0103261_1001495 | 3300007083 | Bacteria | 3733 |
| 39 | Ga0123357_10000248 | 3300009784 | Bacteria | 51506 |
| 40 | Ga0466734_007769 | 3300042623 | Bacteria | 8423 |
| 41 | Ga0466734_095938 | 3300042623 | Bacteria | 4916 |
| 42 | Ga0466704_244902 | 3300042643 | Bacteria | 52327 |
| 43 | Ga0466715_184324 | 3300042616 | Unclassified | 2020 |
| 44 | Ga0160440_100016 | 3300012815 | Bacteria | 324758 |
| 45 | Ga0160469_100057 | 3300012824 | Bacteria | 191828 |
| 46 | Ga0160467_100344 | 3300012829 | Bacteria | 49388 |
| 47 | Ga0160444_100096 | 3300012841 | Bacteria | 110805 |
| 48 | Ga0160443_101747 | 3300012848 | Unclassified | 6259 |
| 49 | Ga0160435_1002466 | 3300012857 | Unclassified | 4493 |
| 50 | Ga0123356_10006584 | 3300010049 | Unclassified | 11706 |
| 51 | Ga0123356_10173136 | 3300010049 | Bacteria | 2172 |
| 52 | Ga0123356_10611445 | 3300010049 | Bacteria | 1255 |
| 53 | Ga0466719_340622 | 3300042606 | Bacteria | 10934 |
| 54 | Ga0102740_1001491 | 3300007140 | Bacteria | 5926 |
| 55 | Ga0466729_232375 | 3300042621 | Bacteria | 60363 |
| 56 | Ga0466730_044445 | 3300042625 | Bacteria | 1804 |
| 57 | Ga0466704_250002 | 3300042643 | Bacteria | 8050 |
| 58 | Ga0466704_555754 | 3300042643 | Bacteria | 3165 |
| 59 | Ga0466708_192936 | 3300042652 | Bacteria | 3674 |
| 60 | Ga0466708_206327 | 3300042652 | Bacteria | 22043 |
| 61 | Ga0466725_023073 | 3300042654 | Bacteria | 10221 |
| 62 | Ga0466725_230125 | 3300042654 | Bacteria | 55475 |
| 63 | Ga0466710_182343 | 3300042613 | Bacteria | 6286 |
| 64 | Ga0466710_249192 | 3300042613 | Bacteria | 63183 |
| 65 | Ga0466729_077694 | 3300042621 | Bacteria | 6277 |
| 66 | Ga0160468_100596 | 3300012819 | Unclassified | 13481 |
| 67 | Ga0160445_101514 | 3300012847 | Unclassified | 6382 |
| 68 | Ga0466691_121855 | 3300042593 | Bacteria | 20312 |
| 69 | Ga0466696_238677 | 3300042596 | Bacteria | 1752 |
| 70 | Ga0466701_027129 | 3300042598 | Bacteria | 3651 |
| 71 | Ga0466719_246513 | 3300042606 | Bacteria | 3822 |
| 72 | Ga0466722_261023 | 3300042609 | Bacteria | 4920 |
| 73 | Ga0102736_1002966 | 3300007052 | Unclassified | 2567 |
| 74 | Ga0102735_1000865 | 3300007080 | Bacteria | 12474 |
| 75 | Ga0103264_1011846 | 3300007188 | Bacteria | 4489 |
| 76 | Ga0466734_068372 | 3300042623 | Bacteria | 2806 |
| 77 | Ga0466724_57906 | 3300042649 | Bacteria | 581904 |
| 78 | Ga0466708_111323 | 3300042652 | Bacteria | 1501 |
| 79 | Ga0466725_221145 | 3300042654 | Bacteria | 45968 |
| 80 | Ga0466705_059463 | 3300042612 | Bacteria | 40059 |
| 81 | Ga0466715_102226 | 3300042616 | Bacteria | 2142 |
| 82 | Ga0466691_013121 | 3300042593 | Bacteria | 1584 |
| 83 | Ga0466696_267532 | 3300042596 | Bacteria | 4508 |
| 84 | Ga0123355_10235264 | 3300009826 | Unclassified | 2607 |
| 85 | Ga0123355_10339137 | 3300009826 | Bacteria | 2004 |
| 86 | Ga0123353_10006326 | 3300010167 | Bacteria | 15750 |
| 87 | Ga0466707_028851 | 3300042601 | Unclassified | 2468 |
| 88 | Ga0466734_106793 | 3300042623 | Bacteria | 14924 |
| 89 | Ga0466725_168530 | 3300042654 | Bacteria | 6180 |
| 90 | Ga0466710_356480 | 3300042613 | Bacteria | 1603 |
| 91 | Ga0466715_474740 | 3300042616 | Bacteria | 2085 |
| 92 | Ga0466729_023340 | 3300042621 | Bacteria | 15752 |
| 93 | Ga0160446_101486 | 3300012835 | Unclassified | 5002 |
| 94 | Ga0160433_100437 | 3300012846 | Bacteria | 21570 |
| 95 | Ga0160445_100028 | 3300012847 | Bacteria | 187936 |
| 96 | Ga0466657_117791 | 3300042582 | Bacteria | 208686 |
| 97 | Ga0466691_131620 | 3300042593 | Bacteria | 6840 |
| 98 | Ga0466695_224256 | 3300042595 | Bacteria | 3935 |
| 99 | Ga0466706_060912 | 3300042599 | Bacteria | 2326 |
| 100 | Ga0466707_187338 | 3300042601 | Bacteria | 3982 |
| 101 | Ga0466719_158372 | 3300042606 | Bacteria | 3036 |
| 102 | DPOL_contig10389 | 2035918003 | Unclassified | 1478 |
| 103 | CVPL010W_10011199 | 3300002931 | Bacteria | 7528 |
| 104 | Ga0103260_1000489 | 3300007139 | Unclassified | 7569 |
| 105 | Ga0103264_1004120 | 3300007188 | Bacteria | 7171 |
| 106 | Ga0466704_409571 | 3300042643 | Bacteria | 1994 |
| 107 | Ga0466708_042504 | 3300042652 | Bacteria | 7526 |
| 108 | Ga0466708_264700 | 3300042652 | Bacteria | 16707 |
| 109 | Ga0466708_370311 | 3300042652 | Bacteria | 15205 |
| 110 | Ga0466711_181637 | 3300042615 | Bacteria | 22291 |
| 111 | Ga0466711_323713 | 3300042615 | Bacteria | 3184 |
| 112 | Ga0466723_327720 | 3300042618 | Bacteria | 2689 |
| 113 | Ga0466726_421841 | 3300042619 | Bacteria | 1295 |
| 114 | Ga0160448_100269 | 3300012854 | Bacteria | 20387 |
| 115 | Ga0466692_040365 | 3300042591 | Bacteria | 62446 |
| 116 | Ga0466693_267907 | 3300042592 | Bacteria | 1488 |
| 117 | Ga0123355_10150520 | 3300009826 | Bacteria | 3536 |
| 118 | Ga0160464_100007 | 3300012805 | Bacteria | 362625 |
| 119 | Ga0466716_027275 | 3300042605 | Bacteria | 3676 |
| 120 | Ga0466719_011199 | 3300042606 | Bacteria | 5103 |
| 121 | IMNBGM34_c000051 | 3300000036 | Bacteria | 32685 |
| 122 | Ga0103266_1001097 | 3300007067 | Bacteria | 6032 |
| 123 | Ga0102739_1001965 | 3300007095 | Bacteria | 3265 |
| 124 | Ga0102739_1002264 | 3300007095 | Bacteria | 3002 |
| 125 | Ga0103268_1000533 | 3300007192 | Bacteria | 11358 |
| 126 | Ga0466725_258002 | 3300042654 | Bacteria | 1221 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00294 | PfkB | pfkB family carbohydrate kinase | 27 | 306 | 0.87 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.