Protein Family IF04620
Metagenome
Isolate
253
Members
91
Samples
211
Scaffolds
343.53
Avg Length
Representative Sequence
- ID
- 3300042591|Ga0466692_034041|Ga0466692_034041_1193_2395
- Length
- 400 aa
- Sequence
- MLVSRHINAAIELSITLFSNCHRINFEYIFIHLYVIRRFYANFAAATVILFDKKMIKNNNTFILQLPAEWEPQSGVMLTWPHRNTDWKPYLEEVIPCFAAIAKAVVRKEKLLIVCASIDEVKADLENIDKSRIIFREIPSNDTWARDHGPIGVRLNGVPYIYDFTFNGWGLKFAANHDNQITKKLFESQAFSSRVGYQDMLHVVLEGGSIESDGEGTLLTTSRCLLSKNRNEYKSKEEIADYFQMIFGLKRILWLNKGYLAGDDTDSHIDTLARFCDPQTIAYVQCTDESDEHFQELSQMEQELQKFKTSDGKPYRLIPLPMADPVYEDGEQLPATYANFLIINEAILMPSYNSPLDEIARLQLQQAFPDREIISINCLPLIKQHGSLHCVTMQLPEGFL
Sample Types
Isolate
16.6%
Metagenome
83.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
36.7%
Termitidae
22.2%
Kalotermitidae
15.6%
Unclassified
11.1%
Rhinotermitidae
4.4%
Termopsidae
4.4%
Passalidae
3.3%
Hodotermitidae
1.1%
Tenebrionidae
1.1%
Taxonomy
Archaea
0
Bacteria
251
Eukaryota
0
Viruses
0
Unclassified
2
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 2 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 3 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 4 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 5 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 6 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 7 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 8 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 9 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 10 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 11 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 12 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 13 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 14 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 15 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 16 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 17 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 18 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 19 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 20 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 21 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 22 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 23 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 24 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 25 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 26 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 27 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 28 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 29 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 30 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 31 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 32 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 33 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 34 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 35 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 36 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 37 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 38 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 39 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 40 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 41 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 42 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 43 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 44 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 45 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 46 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 47 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 48 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 49 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 50 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 51 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 52 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 53 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 54 | 2820750388 | Unclassified Bacteroidetes Nt197P3bin50 | Isolate | Unclassified |
| 55 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 56 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 57 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 58 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 59 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 60 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 61 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 62 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 63 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 64 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 65 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 66 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 67 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 68 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 69 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 70 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 71 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 72 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 73 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 74 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 75 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 76 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 77 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 78 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 79 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 80 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 81 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 82 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 83 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 84 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 85 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 86 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 87 | 3300007733 | Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean | Metagenome | |
| 88 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 89 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 90 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 91 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466711_411906 | 3300042615 | Bacteria | 26972 |
| 2 | Ga0466715_080854 | 3300042616 | Bacteria | 9552 |
| 3 | Ga0466715_157977 | 3300042616 | Bacteria | 113033 |
| 4 | Ga0466715_161055 | 3300042616 | Bacteria | 3254 |
| 5 | Ga0466728_018943 | 3300042620 | Bacteria | 3097 |
| 6 | Ga0466729_060792 | 3300042621 | Bacteria | 4355 |
| 7 | Ga0466729_094177 | 3300042621 | Bacteria | 18601 |
| 8 | Ga0466703_023470 | 3300042636 | Bacteria | 1759 |
| 9 | Ga0466703_024662 | 3300042636 | Bacteria | 2503 |
| 10 | Ga0466703_419893 | 3300042636 | Bacteria | 9964 |
| 11 | Ga0466704_040618 | 3300042643 | Bacteria | 4114 |
| 12 | Ga0466709_217288 | 3300042648 | Bacteria | 7204 |
| 13 | Ga0466706_228110 | 3300042599 | Bacteria | 17738 |
| 14 | Ga0466707_126590 | 3300042601 | Bacteria | 1996 |
| 15 | Ga0466707_382079 | 3300042601 | Bacteria | 1398 |
| 16 | Ga0466713_017181 | 3300042602 | Bacteria | 54753 |
| 17 | Ga0466713_100118 | 3300042602 | Bacteria | 50595 |
| 18 | Ga0466722_157838 | 3300042609 | Bacteria | 26726 |
| 19 | Ga0466690_308833 | 3300042590 | Bacteria | 2465 |
| 20 | Ga0466690_337300 | 3300042590 | Bacteria | 19939 |
| 21 | Ga0466696_022895 | 3300042596 | Bacteria | 1478 |
| 22 | Ga0466696_426504 | 3300042596 | Bacteria | 1488 |
| 23 | 2227499637 | 2225789004 | Bacteria | 19389 |
| 24 | IMNBL1DRAFT_c0000100 | 3300000062 | Bacteria | 75970 |
| 25 | IMNBL1DRAFT_c0000892 | 3300000062 | Bacteria | 23226 |
| 26 | JGI24696J40584_12954813 | 3300002834 | Bacteria | 2710 |
| 27 | Ga0466733_153801 | 3300042659 | Bacteria | 58972 |
| 28 | Ga0466711_286999 | 3300042615 | Bacteria | 21792 |
| 29 | Ga0466723_074859 | 3300042618 | Bacteria | 49235 |
| 30 | Ga0466729_196878 | 3300042621 | Bacteria | 2948 |
| 31 | Ga0123357_10010436 | 3300009784 | Bacteria | 11818 |
| 32 | Ga0123357_10037331 | 3300009784 | Bacteria | 6613 |
| 33 | Ga0123354_10010376 | 3300010882 | Bacteria | 14348 |
| 34 | Ga0466735_037837 | 3300042624 | Bacteria | 12833 |
| 35 | Ga0466725_264850 | 3300042654 | Bacteria | 15661 |
| 36 | Ga0466727_038179 | 3300042655 | Bacteria | 3082 |
| 37 | Ga0466727_092569 | 3300042655 | Bacteria | 43011 |
| 38 | Ga0466700_104719 | 3300042600 | Bacteria | 8667 |
| 39 | Ga0466700_373334 | 3300042600 | Bacteria | 80469 |
| 40 | Ga0466707_096701 | 3300042601 | Bacteria | 20658 |
| 41 | Ga0466707_118200 | 3300042601 | Bacteria | 2173 |
| 42 | Ga0466713_117261 | 3300042602 | Bacteria | 3076 |
| 43 | Ga0466719_317513 | 3300042606 | Bacteria | 22575 |
| 44 | Ga0466722_183009 | 3300042609 | Bacteria | 3441 |
| 45 | Ga0466692_012059 | 3300042591 | Bacteria | 5567 |
| 46 | Ga0466693_399220 | 3300042592 | Bacteria | 4107 |
| 47 | Ga0466696_254225 | 3300042596 | Bacteria | 4856 |
| 48 | Ga0123357_10002011 | 3300009784 | Bacteria | 22277 |
| 49 | Ga0123357_10003582 | 3300009784 | Bacteria | 17889 |
| 50 | Ga0466697_196071 | 3300042611 | Bacteria | 1502 |
| 51 | Ga0466705_292716 | 3300042612 | Bacteria | 1792 |
| 52 | Ga0466733_100021 | 3300042659 | Bacteria | 1392 |
| 53 | Ga0466711_364359 | 3300042615 | Bacteria | 24530 |
| 54 | Ga0466728_003350 | 3300042620 | Bacteria | 7785 |
| 55 | Ga0466729_112650 | 3300042621 | Bacteria | 9382 |
| 56 | Ga0123356_10435661 | 3300010049 | Bacteria | 1456 |
| 57 | Ga0123354_10000997 | 3300010882 | Bacteria | 32229 |
| 58 | Ga0466730_006953 | 3300042625 | Bacteria | 3217 |
| 59 | Ga0466703_033329 | 3300042636 | Bacteria | 27567 |
| 60 | Ga0466703_262133 | 3300042636 | Bacteria | 48736 |
| 61 | Ga0466704_016620 | 3300042643 | Bacteria | 21682 |
| 62 | Ga0466704_072309 | 3300042643 | Bacteria | 9718 |
| 63 | Ga0466704_155788 | 3300042643 | Bacteria | 2596 |
| 64 | Ga0466709_355545 | 3300042648 | Bacteria | 3681 |
| 65 | Ga0466727_061283 | 3300042655 | Bacteria | 22990 |
| 66 | Ga0466701_060434 | 3300042598 | Bacteria | 2996 |
| 67 | Ga0466707_306289 | 3300042601 | Bacteria | 6338 |
| 68 | Ga0466707_399122 | 3300042601 | Bacteria | 7534 |
| 69 | Ga0466707_408156 | 3300042601 | Bacteria | 6074 |
| 70 | Ga0466713_048475 | 3300042602 | Bacteria | 59892 |
| 71 | Ga0466713_088020 | 3300042602 | Bacteria | 4767 |
| 72 | Ga0466713_096596 | 3300042602 | Bacteria | 406546 |
| 73 | Ga0466714_065131 | 3300042603 | Bacteria | 171349 |
| 74 | Ga0466719_251818 | 3300042606 | Bacteria | 5077 |
| 75 | Ga0466722_055125 | 3300042609 | Bacteria | 10250 |
| 76 | Ga0466722_223170 | 3300042609 | Bacteria | 7222 |
| 77 | Ga0466692_111425 | 3300042591 | Bacteria | 39951 |
| 78 | Ga0466691_187954 | 3300042593 | Bacteria | 14021 |
| 79 | Ga0466695_061816 | 3300042595 | Bacteria | 3546 |
| 80 | Ga0466695_284261 | 3300042595 | Bacteria | 1150 |
| 81 | 2227532955 | 2225789004 | Bacteria | 16233 |
| 82 | IMNBL1DRAFT_c0001404 | 3300000062 | Bacteria | 18067 |
| 83 | IMNBL1DRAFT_c0017434 | 3300000062 | Bacteria | 3021 |
| 84 | Ga0105524_104479 | 3300007733 | Bacteria | 2906 |
| 85 | Ga0466733_193225 | 3300042659 | Bacteria | 10045 |
| 86 | Ga0466733_210904 | 3300042659 | Bacteria | 42489 |
| 87 | Ga0466729_122597 | 3300042621 | Bacteria | 5070 |
| 88 | Ga0123357_10209642 | 3300009784 | Bacteria | 2193 |
| 89 | Ga0123356_10058663 | 3300010049 | Bacteria | 3590 |
| 90 | Ga0123354_10000158 | 3300010882 | Bacteria | 54261 |
| 91 | Ga0123354_10050872 | 3300010882 | Bacteria | 6264 |
| 92 | Ga0123354_10127255 | 3300010882 | Bacteria | 3244 |
| 93 | Ga0466734_173724 | 3300042623 | Bacteria | 1292 |
| 94 | Ga0466703_295067 | 3300042636 | Bacteria | 5983 |
| 95 | Ga0466703_316352 | 3300042636 | Bacteria | 4702 |
| 96 | Ga0466704_292092 | 3300042643 | Bacteria | 2518 |
| 97 | Ga0466709_087533 | 3300042648 | Bacteria | 39048 |
| 98 | Ga0466707_151218 | 3300042601 | Bacteria | 1272 |
| 99 | Ga0466707_224699 | 3300042601 | Bacteria | 8852 |
| 100 | Ga0466713_077233 | 3300042602 | Bacteria | 28426 |
| 101 | Ga0466713_097614 | 3300042602 | Bacteria | 86999 |
| 102 | Ga0466713_144221 | 3300042602 | Bacteria | 32905 |
| 103 | Ga0466716_041903 | 3300042605 | Bacteria | 4273 |
| 104 | Ga0466722_050793 | 3300042609 | Bacteria | 19625 |
| 105 | Ga0466696_453146 | 3300042596 | Bacteria | 3566 |
| 106 | 2227175264 | 2225789004 | Bacteria | 8123 |
| 107 | JGI24699J35502_11134149 | 3300002509 | Bacteria | 37817 |
| 108 | Ga0068305_10277711 | 3300005083 | Bacteria | 1298 |
| 109 | Ga0123357_10000452 | 3300009784 | Bacteria | 39673 |
| 110 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 111 | Ga0466715_080167 | 3300042616 | Bacteria | 7544 |
| 112 | Ga0466723_302250 | 3300042618 | Bacteria | 7253 |
| 113 | Ga0123354_10327213 | 3300010882 | Bacteria | 1404 |
| 114 | Ga0466735_102913 | 3300042624 | Bacteria | 1561 |
| 115 | Ga0466703_368209 | 3300042636 | Bacteria | 2985 |
| 116 | Ga0466704_043559 | 3300042643 | Bacteria | 13669 |
| 117 | Ga0466704_123559 | 3300042643 | Bacteria | 4060 |
| 118 | Ga0466704_198926 | 3300042643 | Bacteria | 1898 |
| 119 | Ga0466724_60278 | 3300042649 | Bacteria | 1215 |
| 120 | Ga0466708_088455 | 3300042652 | Bacteria | 19550 |
| 121 | Ga0466708_335829 | 3300042652 | Bacteria | 32448 |
| 122 | Ga0466727_298201 | 3300042655 | Bacteria | 6606 |
| 123 | Ga0466706_270190 | 3300042599 | Bacteria | 37048 |
| 124 | Ga0466707_033125 | 3300042601 | Bacteria | 31808 |
| 125 | Ga0466707_120177 | 3300042601 | Bacteria | 19605 |
| 126 | Ga0466713_080174 | 3300042602 | Bacteria | 6747 |
| 127 | Ga0466713_091467 | 3300042602 | Bacteria | 28175 |
| 128 | Ga0466714_105424 | 3300042603 | Unclassified | 4049 |
| 129 | Ga0466716_095541 | 3300042605 | Bacteria | 62772 |
| 130 | Ga0466690_180120 | 3300042590 | Bacteria | 47306 |
| 131 | Ga0466690_425837 | 3300042590 | Bacteria | 4759 |
| 132 | Ga0466696_313082 | 3300042596 | Bacteria | 2562 |
| 133 | 2227166937 | 2225789004 | Bacteria | 8265 |
| 134 | 2227477420 | 2225789004 | Bacteria | 4585 |
| 135 | IMNBL1DRAFT_c0001681 | 3300000062 | Bacteria | 16336 |
| 136 | IMNBL1DRAFT_c0004122 | 3300000062 | Bacteria | 8875 |
| 137 | JGI24699J35502_11133691 | 3300002509 | Bacteria | 13646 |
| 138 | Ga0068302_10112297 | 3300005071 | Bacteria | 2727 |
| 139 | Ga0068305_10087869 | 3300005083 | Unclassified | 4179 |
| 140 | Ga0466733_088004 | 3300042659 | Bacteria | 203974 |
| 141 | Ga0466723_014851 | 3300042618 | Bacteria | 13167 |
| 142 | Ga0123357_10146043 | 3300009784 | Bacteria | 2889 |
| 143 | Ga0123357_10258089 | 3300009784 | Bacteria | 1848 |
| 144 | Ga0466727_231742 | 3300042655 | Bacteria | 1624 |
| 145 | Ga0466727_313462 | 3300042655 | Bacteria | 28907 |
| 146 | Ga0466700_252361 | 3300042600 | Bacteria | 7259 |
| 147 | Ga0466700_319831 | 3300042600 | Bacteria | 1247 |
| 148 | Ga0466713_020481 | 3300042602 | Bacteria | 2586 |
| 149 | Ga0466716_056386 | 3300042605 | Bacteria | 4970 |
| 150 | Ga0466719_318626 | 3300042606 | Bacteria | 3065 |
| 151 | Ga0466690_283872 | 3300042590 | Bacteria | 9663 |
| 152 | 2227027581 | 2225789003 | Bacteria | 4703 |
| 153 | 2227044272 | 2225789003 | Bacteria | 4070 |
| 154 | Ga0466705_004490 | 3300042612 | Bacteria | 4053 |
| 155 | Ga0466733_141514 | 3300042659 | Bacteria | 10060 |
| 156 | Ga0466723_009248 | 3300042618 | Bacteria | 16639 |
| 157 | Ga0466723_346543 | 3300042618 | Bacteria | 25857 |
| 158 | Ga0466726_226246 | 3300042619 | Bacteria | 10092 |
| 159 | Ga0123357_10111292 | 3300009784 | Bacteria | 3490 |
| 160 | Ga0123357_10173256 | 3300009784 | Bacteria | 2545 |
| 161 | Ga0466735_110974 | 3300042624 | Bacteria | 17649 |
| 162 | Ga0466735_133617 | 3300042624 | Bacteria | 1288 |
| 163 | Ga0466735_170282 | 3300042624 | Bacteria | 7133 |
| 164 | Ga0466730_057907 | 3300042625 | Bacteria | 3372 |
| 165 | Ga0466703_125732 | 3300042636 | Bacteria | 2424 |
| 166 | Ga0466725_245471 | 3300042654 | Bacteria | 12022 |
| 167 | Ga0466701_052963 | 3300042598 | Bacteria | 41459 |
| 168 | Ga0466706_109799 | 3300042599 | Bacteria | 205088 |
| 169 | Ga0466707_200925 | 3300042601 | Bacteria | 2185 |
| 170 | Ga0466707_222596 | 3300042601 | Bacteria | 9583 |
| 171 | Ga0466713_046176 | 3300042602 | Bacteria | 36375 |
| 172 | Ga0466716_021295 | 3300042605 | Bacteria | 6481 |
| 173 | Ga0466722_035543 | 3300042609 | Bacteria | 116913 |
| 174 | Ga0466657_058908 | 3300042582 | Bacteria | 5000 |
| 175 | Ga0466692_034041 | 3300042591 | Bacteria | 4853 |
| 176 | Ga0466692_073366 | 3300042591 | Bacteria | 6685 |
| 177 | IMNBL1DRAFT_c0023890 | 3300000062 | Bacteria | 2382 |
| 178 | JGI24702J35022_10008691 | 3300002462 | Bacteria | 5735 |
| 179 | Ga0466715_187546 | 3300042616 | Bacteria | 7534 |
| 180 | Ga0466726_149436 | 3300042619 | Bacteria | 4406 |
| 181 | Ga0466728_139988 | 3300042620 | Bacteria | 10278 |
| 182 | Ga0466729_142281 | 3300042621 | Bacteria | 1461 |
| 183 | Ga0123357_10027856 | 3300009784 | Bacteria | 7642 |
| 184 | Ga0123357_10275400 | 3300009784 | Bacteria | 1749 |
| 185 | Ga0123355_10002006 | 3300009826 | Bacteria | 28778 |
| 186 | Ga0123354_10026952 | 3300010882 | Bacteria | 9060 |
| 187 | Ga0123354_10160850 | 3300010882 | Bacteria | 2667 |
| 188 | Ga0466735_073314 | 3300042624 | Bacteria | 11166 |
| 189 | Ga0466735_165051 | 3300042624 | Bacteria | 4789 |
| 190 | Ga0466703_058087 | 3300042636 | Bacteria | 19917 |
| 191 | Ga0466703_154317 | 3300042636 | Bacteria | 3252 |
| 192 | Ga0466709_164171 | 3300042648 | Bacteria | 70343 |
| 193 | Ga0466708_104188 | 3300042652 | Bacteria | 6335 |
| 194 | Ga0466727_019825 | 3300042655 | Bacteria | 16582 |
| 195 | Ga0466727_284013 | 3300042655 | Bacteria | 2346 |
| 196 | Ga0466706_134925 | 3300042599 | Bacteria | 10927 |
| 197 | Ga0466713_075045 | 3300042602 | Bacteria | 13360 |
| 198 | Ga0466713_099894 | 3300042602 | Bacteria | 2493 |
| 199 | Ga0466719_574733 | 3300042606 | Bacteria | 6077 |
| 200 | Ga0466722_170787 | 3300042609 | Bacteria | 2411 |
| 201 | Ga0466690_041347 | 3300042590 | Bacteria | 4255 |
| 202 | Ga0466690_151521 | 3300042590 | Bacteria | 11726 |
| 203 | Ga0466690_225142 | 3300042590 | Bacteria | 22517 |
| 204 | Ga0466692_071574 | 3300042591 | Bacteria | 4403 |
| 205 | Ga0466691_062556 | 3300042593 | Bacteria | 20689 |
| 206 | Ga0466696_048266 | 3300042596 | Bacteria | 22095 |
| 207 | Ga0466696_363219 | 3300042596 | Bacteria | 2147 |
| 208 | IMNBL1DRAFT_c0010563 | 3300000062 | Bacteria | 4400 |
| 209 | IMNBL1DRAFT_c0010832 | 3300000062 | Bacteria | 4317 |
| 210 | JGI24705J35276_12238175 | 3300002504 | Bacteria | 16892 |
| 211 | JGI24699J35502_11134212 | 3300002509 | Bacteria | 62331 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF04371 | PAD_porph | Porphyromonas-type peptidyl-arginine deiminase | 66 | 396 | 0.94 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.