Protein Family IF04571

Metagenome Isolate
222 Members
92 Samples
200 Scaffolds
289.6 Avg Length

🧬 Representative Sequence

ID
3300042590|Ga0466690_329801|Ga0466690_329801_497_1531
Length
344 aa
Sequence
VIIFFEVDKKVDFEIKKEGFDFYYMHLEILNFHVTLHFICKCSKKIVGKMETADLLKKVRKIEIKTKGLSGNIFAGEYHSAFKGRGMTFSEVREYQPGDDVRNIDWNVTARFNTPFVKVFEEERELTVMLIIDVSASESFGTQSKFKKDLIAELSAVLSFSASINNDKIGAMFFGSKVEKFIPPQKGRTHILRIIREILEFTPENSGTNISEALAYLTGALKKRCTTFILSDFMDFDENNMPCFEQALKIASKKHDVVALRIFDQREKELPPVGLIEMYDAETGQSVLVNTNRKKNRKIYNNWWNTCSDNLNKIFSKYKVDSVNIATDDDYIKPLVKLFKKRAV

📊 Sample Types

Isolate 9.9%
Metagenome 90.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 32.2%
Unclassified 18.4%
Kalotermitidae 16.1%
Formicidae 9.2%
Drosophilidae 4.6%
Rhinotermitidae 3.4%
Termopsidae 3.4%
Passalidae 2.3%
Elmidae 2.3%
Tenebrionidae 1.1%
Daphniidae 1.1%
Hodotermitidae 1.1%
Cambaridae 1.1%
Kiwaidae 1.1%
Armadillidiidae 1.1%
Nephropidae 1.1%

🌳 Taxonomy

Archaea 0
Bacteria 207
Eukaryota 0
Viruses 0
Unclassified 15

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820795054 Unclassified Bacteroidetes Cu122P1bin21 Isolate Unclassified
2 2899132286 Myroides albus BIT-d1 Isolate Tenebrionidae
3 2820755292 Unclassified Bacteroidetes Nc150P3bin3 Isolate Unclassified
4 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
5 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
6 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
7 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
8 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
9 2820788205 Unclassified Bacteroidetes Emb289P1bin57 Isolate Unclassified
10 2894649344 Allomuricauda alvinocaridis SCR12 Isolate Unclassified
11 2904728850 Flavobacterium sp. xlx-214 Isolate
12 2811995047 Flavobacterium succinicans DD5b Isolate Daphniidae
13 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
14 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
15 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
16 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
17 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
18 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
19 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
20 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
21 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
22 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
23 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
24 2820770630 Unclassified Bacteroidetes Lab288P3bin130 Isolate Unclassified
25 2882250448 Bizionia sp. APA-3 Isolate
26 2820746860 Unclassified Bacteroidetes Th196P3bin126 Isolate Unclassified
27 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
28 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
29 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
30 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
31 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
32 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
33 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
34 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
35 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
36 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
37 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
38 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
39 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
40 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
41 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
42 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
43 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
44 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
45 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
46 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
47 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
48 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
49 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
50 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
51 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
52 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
53 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
54 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
55 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
56 2820785563 Unclassified Bacteroidetes Emb289P1bin74 Isolate Unclassified
57 2820792843 Unclassified Bacteroidetes Cu122P3bin1 Isolate Unclassified
58 2958471994 Flavobacterium sp. xlx-221 Isolate Cambaridae
59 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
60 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
61 3300007068 Ant gut microbial communities from Cephalotes simillimus, Peru Metagenome Formicidae
62 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
63 3300013007 Symbiotic microbial communities associated with the hydrothermal yeti crab kiwa sp. n. from the East Pacific Rise in the East Pacific Ocean - crab 1, guts Metagenome Kiwaidae
64 2820786992 Unclassified Bacteroidetes Emb289P1bin66 Isolate Unclassified
65 2864878056 Flavobacterium notoginsengisoli S00128 Isolate Elmidae
66 2864886855 Flavobacterium nitrogenifigens S00142 Isolate Elmidae
67 2718218155 Flavobacteriaceae bacterium UJ101 Isolate
68 3300007143 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut Metagenome Drosophilidae
69 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
70 2820797595 Unclassified Bacteroidetes Co191P3bin3 Isolate Unclassified
71 2838772460 Aquimarina sp. I32.4 Isolate Nephropidae
72 2820753519 Unclassified Bacteroidetes Nc150P4bin20 Isolate Unclassified
73 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
74 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
75 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
76 3300007150 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut Metagenome Drosophilidae
77 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
78 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
79 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
80 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
81 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
82 2820789850 Unclassified Bacteroidetes Cu122P3bin3 Isolate Unclassified
83 2820735654 Unclassified Bacteroidetes Th196P4bin9 Isolate Unclassified
84 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
85 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
86 3300012828 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG Metagenome
87 3300005307 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 1 gut Metagenome Drosophilidae
88 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
89 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
90 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
91 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
92 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123354_10247272 3300010882 Bacteria 1817
2 Ga0466705_488092 3300042612 Bacteria 21416
3 Ga0466711_018792 3300042615 Bacteria 12875
4 Ga0466715_273774 3300042616 Bacteria 12241
5 Ga0466723_330251 3300042618 Bacteria 6137
6 Ga0157631_122095 3300013007 Bacteria 2593
7 Ga0415639_064994 3300038395 Unclassified 2067
8 Ga0466690_157295 3300042590 Bacteria 5196
9 Ga0466692_064682 3300042591 Bacteria 2653
10 Ga0466691_019459 3300042593 Bacteria 12063
11 Ga0466691_055360 3300042593 Bacteria 60253
12 Ga0466691_118583 3300042593 Bacteria 5146
13 Ga0466696_269227 3300042596 Bacteria 6396
14 IMNBL1DRAFT_c0022028 3300000062 Bacteria 2532
15 JGI24702J35022_10013055 3300002462 Bacteria 4608
16 Ga0068302_10013229 3300005071 Bacteria 5843
17 Ga0102737_1000052 3300007142 Bacteria 34662
18 Ga0466701_077142 3300042598 Bacteria 16041
19 Ga0466716_354110 3300042605 Bacteria 6364
20 Ga0466722_141618 3300042609 Bacteria 12339
21 Ga0466722_151148 3300042609 Bacteria 4280
22 Ga0466731_000856 3300042622 Bacteria 2969
23 Ga0466703_362470 3300042636 Bacteria 4438
24 Ga0466697_225443 3300042611 Bacteria 1034
25 Ga0123355_10090818 3300009826 Bacteria 4844
26 Ga0123353_10015319 3300010167 Bacteria 11127
27 Ga0123354_10045316 3300010882 Unclassified 6731
28 Ga0466710_093950 3300042613 Bacteria 1674
29 Ga0466710_326489 3300042613 Bacteria 3198
30 Ga0466712_286395 3300042614 Bacteria 1259
31 Ga0466715_065955 3300042616 Bacteria 4203
32 Ga0466657_100498 3300042582 Bacteria 18371
33 Ga0466657_222210 3300042582 Bacteria 2802
34 Ga0466690_101320 3300042590 Unclassified 1699
35 Ga0466692_108411 3300042591 Bacteria 15895
36 IMNBL1DRAFT_c0004837 3300000062 Bacteria 7940
37 Ga0466701_021588 3300042598 Bacteria 47878
38 Ga0466713_101459 3300042602 Bacteria 26532
39 Ga0466717_144505 3300042604 Unclassified 1269
40 Ga0466722_268669 3300042609 Bacteria 10988
41 Ga0466731_383201 3300042622 Bacteria 1200
42 Ga0466703_029191 3300042636 Bacteria 4361
43 Ga0466703_126686 3300042636 Bacteria 2586
44 Ga0466704_497889 3300042643 Bacteria 43988
45 Ga0466697_262029 3300042611 Bacteria 1966
46 Ga0466732_304541 3300042656 Bacteria 4819
47 Ga0466732_354839 3300042656 Bacteria 2507
48 Ga0466732_417766 3300042656 Bacteria 2789
49 Ga0123356_10005976 3300010049 Bacteria 12349
50 Ga0123353_10002109 3300010167 Bacteria 24588
51 Ga0123353_10173923 3300010167 Bacteria 3416
52 Ga0123354_10396776 3300010882 Bacteria 1173
53 Ga0466710_214354 3300042613 Bacteria 1899
54 Ga0466726_448249 3300042619 Unclassified 2682
55 Ga0466728_264615 3300042620 Bacteria 7345
56 Ga0466690_269579 3300042590 Bacteria 4837
57 Ga0466690_329801 3300042590 Bacteria 5195
58 Ga0466692_088232 3300042591 Bacteria 3025
59 Ga0466693_071824 3300042592 Bacteria 1388
60 Ga0466691_019039 3300042593 Bacteria 15517
61 Ga0466695_258278 3300042595 Bacteria 3688
62 Ga0466696_213488 3300042596 Bacteria 5031
63 Ga0466699_021565 3300042597 Bacteria 4075
64 JGI24695J34938_10004781 3300002450 Bacteria 8719
65 JGI24702J35022_10005067 3300002462 Bacteria 7757
66 CVPL010W_10001888 3300002931 Bacteria 45788
67 Ga0103267_1001135 3300007190 Bacteria 6607
68 Ga0466706_029599 3300042599 Bacteria 23165
69 Ga0466706_177292 3300042599 Bacteria 3664
70 Ga0466700_015001 3300042600 Bacteria 10860
71 Ga0466717_162587 3300042604 Bacteria 3917
72 Ga0466719_386066 3300042606 Bacteria 1461
73 Ga0466720_196164 3300042607 Bacteria 2279
74 Ga0466698_032574 3300042610 Bacteria 1058
75 Ga0466724_31863 3300042649 Bacteria 2420
76 Ga0466724_53060 3300042649 Bacteria 1311
77 Ga0466697_066136 3300042611 Bacteria 3416
78 Ga0466705_052613 3300042612 Unclassified 6785
79 Ga0466733_157359 3300042659 Bacteria 5024
80 Ga0123356_10003831 3300010049 Bacteria 15662
81 Ga0123353_10000454 3300010167 Bacteria 50966
82 Ga0123354_10008581 3300010882 Bacteria 15551
83 Ga0466710_264452 3300042613 Bacteria 3812
84 Ga0466723_238207 3300042618 Bacteria 6901
85 Ga0466726_097810 3300042619 Unclassified 4565
86 Ga0466696_080985 3300042596 Bacteria 38621
87 Ga0466696_168122 3300042596 Bacteria 10947
88 JGI24702J35022_10000261 3300002462 Bacteria 30179
89 JGI24696J40584_12941644 3300002834 Unclassified 1715
90 Ga0104045_1001140 3300007085 Bacteria 13426
91 Ga0102734_1000385 3300007129 Bacteria 12777
92 Ga0466707_390112 3300042601 Bacteria 4247
93 Ga0466716_178779 3300042605 Bacteria 7809
94 Ga0466698_417227 3300042610 Bacteria 2481
95 Ga0466731_231068 3300042622 Bacteria 3899
96 Ga0466731_403034 3300042622 Bacteria 1925
97 Ga0466709_081885 3300042648 Bacteria 5993
98 Ga0466724_28891 3300042649 Bacteria 455231
99 Ga0466732_372506 3300042656 Bacteria 121204
100 Ga0466733_013242 3300042659 Unclassified 2083
101 Ga0466733_109902 3300042659 Bacteria 2843
102 Ga0466733_163016 3300042659 Bacteria 5575
103 Ga0123353_10037734 3300010167 Bacteria 7582
104 Ga0123353_10204089 3300010167 Bacteria 3106
105 Ga0466711_185108 3300042615 Bacteria 11364
106 Ga0466723_082387 3300042618 Unclassified 5014
107 Ga0466723_293502 3300042618 Bacteria 25263
108 Ga0466729_140215 3300042621 Bacteria 1911
109 Ga0466690_009509 3300042590 Bacteria 6421
110 Ga0466690_115158 3300042590 Bacteria 8803
111 JGI24702J35022_10143589 3300002462 Bacteria 1334
112 JGI24705J35276_12161214 3300002504 Bacteria 1234
113 Ga0103265_1000086 3300007068 Bacteria 18456
114 Ga0102739_1000052 3300007095 Bacteria 32705
115 Ga0104048_1000550 3300007143 Bacteria 5915
116 Ga0104048_1020704 3300007143 Bacteria 2871
117 Ga0104019_1001182 3300007150 Unclassified 1873
118 Ga0466701_057256 3300042598 Bacteria 13549
119 Ga0466713_133699 3300042602 Bacteria 32062
120 Ga0466714_005006 3300042603 Bacteria 5069
121 Ga0466714_005050 3300042603 Bacteria 21343
122 Ga0466714_046228 3300042603 Bacteria 4231
123 Ga0466714_064802 3300042603 Bacteria 1658
124 Ga0466714_071053 3300042603 Bacteria 2857
125 Ga0466719_210528 3300042606 Bacteria 7747
126 Ga0466731_253235 3300042622 Bacteria 51566
127 Ga0466734_002649 3300042623 Bacteria 1499
128 Ga0466704_136608 3300042643 Bacteria 15825
129 Ga0466697_281357 3300042611 Bacteria 2576
130 Ga0123354_10134117 3300010882 Bacteria 3108
131 Ga0466705_422513 3300042612 Bacteria 14401
132 Ga0466705_504587 3300042612 Bacteria 4248
133 Ga0466723_238649 3300042618 Unclassified 15901
134 Ga0466728_250187 3300042620 Bacteria 12493
135 Ga0466729_091428 3300042621 Bacteria 10013
136 Ga0160431_101799 3300012828 Bacteria 5647
137 Ga0466657_016523 3300042582 Bacteria 6840
138 Ga0466690_301325 3300042590 Bacteria 3853
139 IMNBGM34_c002990 3300000036 Bacteria 2380
140 IMNBGM34_c007540 3300000036 Bacteria 1400
141 JGI24696J40584_12936609 3300002834 Bacteria 1584
142 Ga0074308_1113558 3300005307 Bacteria 3424
143 Ga0103268_1000027 3300007192 Bacteria 47563
144 Ga0466701_102031 3300042598 Bacteria 201577
145 Ga0466714_101423 3300042603 Bacteria 1645
146 Ga0466716_031032 3300042605 Bacteria 4802
147 Ga0466722_147201 3300042609 Bacteria 28195
148 Ga0466731_047117 3300042622 Bacteria 1664
149 Ga0466704_421149 3300042643 Bacteria 33743
150 Ga0466704_473467 3300042643 Unclassified 3481
151 Ga0466708_073613 3300042652 Bacteria 4298
152 Ga0466708_122528 3300042652 Bacteria 19009
153 Ga0466727_059142 3300042655 Bacteria 16224
154 Ga0466733_118931 3300042659 Bacteria 23201
155 Ga0123356_10599052 3300010049 Unclassified 1267
156 Ga0123353_10219152 3300010167 Bacteria 2977
157 Ga0123353_10467866 3300010167 Bacteria 1849
158 Ga0123353_10820464 3300010167 Bacteria 1281
159 Ga0123353_11064821 3300010167 Bacteria 1078
160 Ga0123353_11265525 3300010167 Bacteria 961
161 Ga0466710_440248 3300042613 Bacteria 5620
162 Ga0466711_104293 3300042615 Bacteria 9463
163 Ga0160457_1001675 3300012858 Bacteria 5671
164 Ga0466694_296134 3300042594 Bacteria 15761
165 Ga0466695_244338 3300042595 Bacteria 1331
166 Ga0466696_395311 3300042596 Bacteria 10238
167 JGI24695J34938_10034110 3300002450 Bacteria 2336
168 Ga0068302_10008735 3300005071 Bacteria 6359
169 Ga0068305_10068494 3300005083 Bacteria 37295
170 Ga0104048_1171448 3300007143 Bacteria 1482
171 Ga0103267_1006937 3300007190 Bacteria 5101
172 Ga0466701_069250 3300042598 Bacteria 2110
173 Ga0466714_038352 3300042603 Bacteria 65655
174 Ga0466714_161762 3300042603 Bacteria 2370
175 Ga0466716_215211 3300042605 Bacteria 2135
176 Ga0466722_176256 3300042609 Bacteria 2154
177 Ga0466703_017988 3300042636 Bacteria 8088
178 Ga0466727_211710 3300042655 Bacteria 6245
179 Ga0466697_237112 3300042611 Bacteria 5222
180 Ga0466705_010291 3300042612 Bacteria 7078
181 Ga0466705_133667 3300042612 Bacteria 38257
182 Ga0466705_254607 3300042612 Bacteria 1563
183 Ga0466733_153087 3300042659 Bacteria 3270
184 Ga0123353_10009288 3300010167 Bacteria 13545
185 Ga0123354_10283885 3300010882 Bacteria 1601
186 Ga0160464_100081 3300012805 Bacteria 110703
187 Ga0466715_025272 3300042616 Bacteria 13623
188 Ga0466657_089160 3300042582 Unclassified 3032
189 Ga0102735_1003178 3300007080 Bacteria 2347
190 Ga0104048_1004004 3300007143 Bacteria 12426
191 Ga0466701_082893 3300042598 Bacteria 37923
192 Ga0466706_017943 3300042599 Bacteria 35858
193 Ga0466714_042148 3300042603 Bacteria 2773
194 Ga0466714_043463 3300042603 Bacteria 6651
195 Ga0466714_087391 3300042603 Bacteria 1560
196 Ga0466719_524590 3300042606 Bacteria 5476
197 Ga0466720_134367 3300042607 Bacteria 2431
198 Ga0466697_016413 3300042611 Bacteria 1982
199 Ga0466703_243709 3300042636 Bacteria 10168
200 Ga0466708_046779 3300042652 Bacteria 15632

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01882 DUF58 Protein of unknown function DUF58 86 170 0.97
PF13519 VWA_2 von Willebrand factor type A domain 128 232 0.94

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.