Protein Family IF04560
Metagenome
Isolate
121
Members
59
Samples
97
Scaffolds
255.17
Avg Length
Representative Sequence
- ID
- 3300042590|Ga0466690_302796|Ga0466690_302796_2363_3283
- Length
- 306 aa
- Sequence
- MPYLFSLSYLFIHGYQGSKNNLLFNESGAYPLFIFIKYTFCDYLCPRNITKEHVLNRYFIYLAYNGKNYNGWQVQPNGVTVQATVEGALATLLRSPVPVVGAGRTDTGVHARRMVAHFDWHEPLTPLSFLTEKLNRILPRDIAIDKIVPVKEDAHARFDALSRTYTYYITTKKDPFTCEFAYKLHGVLDVDVMNKACEILYGYIDFTSFSKLHTDVKTNHCRISHARWEQEGDAWRFSITADRFLRNMVRAIVGTLIETGRGKLSLHGFSAIIEAKDRGRAGMSVPGHALFLTDIAYPGELFTINE
Sample Types
Isolate
19.8%
Metagenome
80.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
34.5%
Termitidae
19.0%
Kalotermitidae
19.0%
Unclassified
8.6%
Rhinotermitidae
6.9%
Termopsidae
5.2%
Passalidae
3.4%
Hodotermitidae
1.7%
Hydrophilidae
1.7%
Taxonomy
Archaea
0
Bacteria
117
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 2 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 3 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 4 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 5 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 6 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 7 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 8 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 9 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 10 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 11 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 12 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 13 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 14 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 15 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 16 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 17 | 643348524 | Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 | Isolate | Unclassified |
| 18 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 19 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 20 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 21 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 22 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 23 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 24 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 25 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 26 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 27 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 28 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 29 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 30 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 31 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 32 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 33 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 34 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 35 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 36 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 37 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 38 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 39 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 40 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 41 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 42 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 43 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 44 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 45 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 46 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 47 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 48 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 49 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 50 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 51 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 52 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 53 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 54 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 55 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 56 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 57 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 58 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 59 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_107968 | 3300042659 | Bacteria | 1476 |
| 2 | Ga0466713_076593 | 3300042602 | Bacteria | 3573 |
| 3 | Ga0466716_175724 | 3300042605 | Bacteria | 9919 |
| 4 | Ga0466719_329398 | 3300042606 | Bacteria | 7268 |
| 5 | Ga0466690_081733 | 3300042590 | Bacteria | 11404 |
| 6 | Ga0466715_027200 | 3300042616 | Bacteria | 40765 |
| 7 | Ga0466704_074072 | 3300042643 | Bacteria | 1778 |
| 8 | Ga0466727_306236 | 3300042655 | Bacteria | 1179 |
| 9 | Ga0466707_043559 | 3300042601 | Bacteria | 24774 |
| 10 | Ga0466722_013414 | 3300042609 | Bacteria | 34349 |
| 11 | Ga0265387_1002205 | 3300024582 | Bacteria | 2764 |
| 12 | Ga0466690_302796 | 3300042590 | Bacteria | 11233 |
| 13 | Ga0466710_157055 | 3300042613 | Bacteria | 14516 |
| 14 | Ga0466715_029087 | 3300042616 | Bacteria | 29670 |
| 15 | Ga0466715_508851 | 3300042616 | Bacteria | 15257 |
| 16 | Ga0466735_181660 | 3300042624 | Bacteria | 2596 |
| 17 | Ga0466730_085458 | 3300042625 | Bacteria | 2268 |
| 18 | Ga0466703_108796 | 3300042636 | Bacteria | 11244 |
| 19 | Ga0466703_200544 | 3300042636 | Bacteria | 7899 |
| 20 | Ga0466704_079962 | 3300042643 | Bacteria | 2885 |
| 21 | Ga0466704_115231 | 3300042643 | Bacteria | 29648 |
| 22 | Ga0466704_139219 | 3300042643 | Bacteria | 3587 |
| 23 | Ga0466709_047096 | 3300042648 | Bacteria | 173163 |
| 24 | Ga0466709_120883 | 3300042648 | Bacteria | 9734 |
| 25 | Ga0466733_166181 | 3300042659 | Bacteria | 14983 |
| 26 | Ga0466713_102098 | 3300042602 | Bacteria | 100663 |
| 27 | Ga0466713_132210 | 3300042602 | Bacteria | 46954 |
| 28 | Ga0466722_009058 | 3300042609 | Bacteria | 56021 |
| 29 | Ga0466715_075610 | 3300042616 | Bacteria | 14367 |
| 30 | Ga0466715_369648 | 3300042616 | Bacteria | 30222 |
| 31 | Ga0466729_167721 | 3300042621 | Unclassified | 18026 |
| 32 | Ga0068305_10763824 | 3300005083 | Bacteria | 3086 |
| 33 | Ga0466735_000318 | 3300042624 | Bacteria | 2235 |
| 34 | Ga0466735_032025 | 3300042624 | Bacteria | 2346 |
| 35 | Ga0466735_034885 | 3300042624 | Bacteria | 1732 |
| 36 | Ga0466735_126436 | 3300042624 | Bacteria | 2233 |
| 37 | Ga0466704_173801 | 3300042643 | Bacteria | 4453 |
| 38 | Ga0466705_034832 | 3300042612 | Bacteria | 3284 |
| 39 | Ga0466707_417823 | 3300042601 | Bacteria | 1589 |
| 40 | Ga0466714_139060 | 3300042603 | Bacteria | 50968 |
| 41 | Ga0466719_453528 | 3300042606 | Bacteria | 4007 |
| 42 | Ga0466697_056567 | 3300042611 | Bacteria | 485126 |
| 43 | Ga0123356_10761736 | 3300010049 | Bacteria | 1138 |
| 44 | 2227544066 | 2225789004 | Bacteria | 15495 |
| 45 | IMNBL1DRAFT_c0001683 | 3300000062 | Bacteria | 16323 |
| 46 | IMNBL1DRAFT_c0033391 | 3300000062 | Bacteria | 1843 |
| 47 | Ga0466703_386985 | 3300042636 | Bacteria | 3284 |
| 48 | Ga0466733_220888 | 3300042659 | Bacteria | 25948 |
| 49 | Ga0466713_051127 | 3300042602 | Bacteria | 13157 |
| 50 | Ga0466713_130991 | 3300042602 | Bacteria | 214088 |
| 51 | Ga0466716_285550 | 3300042605 | Bacteria | 6821 |
| 52 | Ga0466657_046064 | 3300042582 | Bacteria | 11034 |
| 53 | Ga0123354_10223805 | 3300010882 | Bacteria | 1990 |
| 54 | Ga0466711_355417 | 3300042615 | Bacteria | 2712 |
| 55 | Ga0466728_123149 | 3300042620 | Bacteria | 5205 |
| 56 | IMNBL1DRAFT_c0004641 | 3300000062 | Bacteria | 8159 |
| 57 | Ga0466735_104468 | 3300042624 | Bacteria | 1180 |
| 58 | Ga0466705_288537 | 3300042612 | Bacteria | 5794 |
| 59 | Ga0466713_016019 | 3300042602 | Bacteria | 439221 |
| 60 | Ga0466713_017440 | 3300042602 | Bacteria | 108493 |
| 61 | Ga0466713_062719 | 3300042602 | Bacteria | 59430 |
| 62 | Ga0466713_119741 | 3300042602 | Bacteria | 23414 |
| 63 | Ga0466696_319882 | 3300042596 | Bacteria | 5979 |
| 64 | Ga0466711_092577 | 3300042615 | Bacteria | 8561 |
| 65 | Ga0466711_223836 | 3300042615 | Bacteria | 37949 |
| 66 | Ga0466729_117018 | 3300042621 | Bacteria | 4379 |
| 67 | Ga0068302_10200652 | 3300005071 | Bacteria | 5068 |
| 68 | Ga0466729_231410 | 3300042621 | Unclassified | 2579 |
| 69 | Ga0466703_036422 | 3300042636 | Bacteria | 6655 |
| 70 | Ga0466704_230836 | 3300042643 | Bacteria | 1813 |
| 71 | Ga0466704_245229 | 3300042643 | Unclassified | 1127 |
| 72 | Ga0466704_295684 | 3300042643 | Bacteria | 12004 |
| 73 | Ga0466705_173999 | 3300042612 | Bacteria | 9692 |
| 74 | Ga0466706_090349 | 3300042599 | Bacteria | 1255 |
| 75 | Ga0466707_007028 | 3300042601 | Bacteria | 10664 |
| 76 | Ga0466717_313791 | 3300042604 | Bacteria | 1478 |
| 77 | Ga0466722_252821 | 3300042609 | Bacteria | 235840 |
| 78 | Ga0466692_161407 | 3300042591 | Bacteria | 42971 |
| 79 | Ga0466696_122411 | 3300042596 | Bacteria | 19339 |
| 80 | Ga0466701_012719 | 3300042598 | Bacteria | 19345 |
| 81 | Ga0466711_039341 | 3300042615 | Bacteria | 6951 |
| 82 | Ga0466729_112858 | 3300042621 | Bacteria | 4505 |
| 83 | Ga0466703_320358 | 3300042636 | Bacteria | 44545 |
| 84 | Ga0466704_169199 | 3300042643 | Bacteria | 10314 |
| 85 | Ga0466709_139699 | 3300042648 | Bacteria | 2049 |
| 86 | Ga0466705_252608 | 3300042612 | Bacteria | 2015 |
| 87 | Ga0466706_143561 | 3300042599 | Bacteria | 5184 |
| 88 | Ga0466706_287334 | 3300042599 | Bacteria | 2690 |
| 89 | Ga0466690_055606 | 3300042590 | Bacteria | 6936 |
| 90 | Ga0466690_254463 | 3300042590 | Bacteria | 5966 |
| 91 | Ga0466692_109685 | 3300042591 | Bacteria | 126606 |
| 92 | Ga0466693_066346 | 3300042592 | Bacteria | 1415 |
| 93 | Ga0466696_020375 | 3300042596 | Bacteria | 1639 |
| 94 | Ga0466710_130038 | 3300042613 | Unclassified | 4971 |
| 95 | Ga0466715_063709 | 3300042616 | Bacteria | 13117 |
| 96 | Ga0466715_470230 | 3300042616 | Bacteria | 12101 |
| 97 | Ga0466704_373926 | 3300042643 | Bacteria | 2508 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01416 | PseudoU_synth_1 | tRNA pseudouridine synthase | 196 | 298 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.