Protein Family IF04519
Metagenome
Isolate
175
Members
55
Samples
167
Scaffolds
287.54
Avg Length
Representative Sequence
- ID
- 3300042590|Ga0466690_181924|Ga0466690_181924_1058_1993
- Length
- 311 aa
- Sequence
- MCFKPLKKHFVKNKEKIMEKIGFIGLGIMGRPMAKNLIKAGYKLVVYDKFAKLDDVVALGAEGAASSKEVAAKSDIIITMLPNSPHVQEAVCGVDGILEGVKRGAIVVDMSSIAPAVSQEVGVALKSKGVAFLDAPVSGGEPKAIDGTLAIMVGGDKAPFDTVKPILEKMGSSVTFVGGIGSGNVTKLANQIIVALNIAAVSEALVLATKAGVDPQLVFDAIKGGLAGSTVMNAKVPMILDGNFKPGFRIELHIKDLQNALDTAHTLGVPIPLTASVMETLQALKNDGCAANDHSAIVKFYEKLAQIEVRK
Sample Types
Isolate
4.6%
Metagenome
95.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
41.5%
Kalotermitidae
26.4%
Unclassified
17.0%
Termopsidae
7.5%
Rhinotermitidae
7.5%
Taxonomy
Archaea
0
Bacteria
170
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125652 | Treponema sp. Cu122P5bin1 | Isolate | Unclassified |
| 2 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 3 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 4 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 5 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 6 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 7 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 8 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 9 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 10 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 11 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 12 | 2820483401 | Unclassified Firmicutes Lab288P1bin74 | Isolate | Unclassified |
| 13 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 14 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 15 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 16 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 17 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 18 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 19 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 20 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 21 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 22 | 2781125688 | Treponema sp. Lab288P4bin13 | Isolate | Unclassified |
| 23 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 24 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 25 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 26 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 27 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 28 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 29 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 30 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 31 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 32 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 33 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 34 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 35 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 36 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 37 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 38 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 39 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 40 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 41 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 42 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 43 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 44 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 45 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 46 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 47 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 48 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 49 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 50 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 51 | 2781125632 | Treponema sp. Co191P1bin87 | Isolate | Unclassified |
| 52 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 53 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 54 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 55 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123353_10286172 | 3300010167 | Bacteria | 2527 |
| 2 | Ga0466711_230349 | 3300042615 | Bacteria | 7865 |
| 3 | Ga0466711_295767 | 3300042615 | Bacteria | 2255 |
| 4 | Ga0466715_080822 | 3300042616 | Unclassified | 1928 |
| 5 | Ga0466718_006033 | 3300042617 | Bacteria | 1283 |
| 6 | Ga0466718_148910 | 3300042617 | Bacteria | 34374 |
| 7 | Ga0264413_124902 | 3300024493 | Bacteria | 1475 |
| 8 | Ga0466719_187816 | 3300042606 | Bacteria | 6299 |
| 9 | Ga0466719_308770 | 3300042606 | Bacteria | 1954 |
| 10 | Ga0466719_476121 | 3300042606 | Bacteria | 3630 |
| 11 | Ga0466722_028834 | 3300042609 | Bacteria | 11353 |
| 12 | Ga0466722_130397 | 3300042609 | Bacteria | 4800 |
| 13 | Ga0466722_174138 | 3300042609 | Bacteria | 6431 |
| 14 | JGI24698J34947_10034345 | 3300002449 | Bacteria | 2655 |
| 15 | Ga0466735_172229 | 3300042624 | Bacteria | 1134 |
| 16 | Ga0466727_048249 | 3300042655 | Bacteria | 2270 |
| 17 | Ga0466727_133301 | 3300042655 | Unclassified | 1871 |
| 18 | Ga0466705_026349 | 3300042612 | Bacteria | 21268 |
| 19 | Ga0123357_10093179 | 3300009784 | Bacteria | 3916 |
| 20 | Ga0123355_10626340 | 3300009826 | Bacteria | 1266 |
| 21 | Ga0123354_10233209 | 3300010882 | Unclassified | 1917 |
| 22 | Ga0466715_617084 | 3300042616 | Bacteria | 12140 |
| 23 | Ga0466718_010396 | 3300042617 | Bacteria | 2029 |
| 24 | Ga0466726_188860 | 3300042619 | Bacteria | 5521 |
| 25 | Ga0466728_313247 | 3300042620 | Bacteria | 1243 |
| 26 | Ga0456237_0004106 | 3300041968 | Bacteria | 2343 |
| 27 | Ga0466692_062140 | 3300042591 | Bacteria | 6358 |
| 28 | Ga0466691_053921 | 3300042593 | Bacteria | 3822 |
| 29 | Ga0466691_109493 | 3300042593 | Bacteria | 23172 |
| 30 | Ga0466700_373983 | 3300042600 | Bacteria | 2027 |
| 31 | Ga0466707_059531 | 3300042601 | Bacteria | 3517 |
| 32 | Ga0466707_136297 | 3300042601 | Bacteria | 1242 |
| 33 | Ga0466719_048024 | 3300042606 | Bacteria | 5002 |
| 34 | Ga0466698_044560 | 3300042610 | Bacteria | 1326 |
| 35 | Ga0466702_240393 | 3300042635 | Bacteria | 2392 |
| 36 | Ga0466703_207668 | 3300042636 | Bacteria | 20271 |
| 37 | Ga0466705_030939 | 3300042612 | Bacteria | 5057 |
| 38 | Ga0466705_324741 | 3300042612 | Bacteria | 3382 |
| 39 | Ga0123357_10019092 | 3300009784 | Bacteria | 9127 |
| 40 | Ga0466712_203641 | 3300042614 | Bacteria | 18970 |
| 41 | Ga0466718_119242 | 3300042617 | Bacteria | 1614 |
| 42 | Ga0466723_158968 | 3300042618 | Bacteria | 7540 |
| 43 | Ga0264413_120307 | 3300024493 | Bacteria | 8770 |
| 44 | Ga0415639_233863 | 3300038395 | Bacteria | 1942 |
| 45 | Ga0466690_181924 | 3300042590 | Bacteria | 4472 |
| 46 | Ga0466696_009446 | 3300042596 | Bacteria | 7280 |
| 47 | Ga0466699_002401 | 3300042597 | Bacteria | 74503 |
| 48 | Ga0466699_051861 | 3300042597 | Bacteria | 28735 |
| 49 | Ga0466700_398054 | 3300042600 | Bacteria | 1965 |
| 50 | Ga0466707_169883 | 3300042601 | Bacteria | 3293 |
| 51 | Ga0466707_206106 | 3300042601 | Bacteria | 3562 |
| 52 | Ga0466707_363851 | 3300042601 | Bacteria | 1454 |
| 53 | Ga0466719_149555 | 3300042606 | Bacteria | 1831 |
| 54 | Ga0466735_165528 | 3300042624 | Unclassified | 1227 |
| 55 | Ga0466703_194546 | 3300042636 | Bacteria | 15604 |
| 56 | Ga0466704_149556 | 3300042643 | Bacteria | 3103 |
| 57 | Ga0466704_240823 | 3300042643 | Bacteria | 65386 |
| 58 | Ga0466709_344833 | 3300042648 | Bacteria | 5951 |
| 59 | Ga0466708_395619 | 3300042652 | Bacteria | 1617 |
| 60 | Ga0466727_205836 | 3300042655 | Bacteria | 2042 |
| 61 | Ga0123357_10098389 | 3300009784 | Bacteria | 3782 |
| 62 | Ga0123357_10136366 | 3300009784 | Bacteria | 3034 |
| 63 | Ga0123357_10353618 | 3300009784 | Bacteria | 1402 |
| 64 | Ga0466711_227825 | 3300042615 | Bacteria | 191336 |
| 65 | Ga0466715_116296 | 3300042616 | Bacteria | 10085 |
| 66 | Ga0466723_364979 | 3300042618 | Bacteria | 7946 |
| 67 | Ga0466692_154679 | 3300042591 | Bacteria | 3064 |
| 68 | Ga0466699_030314 | 3300042597 | Bacteria | 7653 |
| 69 | Ga0466719_496478 | 3300042606 | Bacteria | 1931 |
| 70 | Ga0466720_028434 | 3300042607 | Bacteria | 9245 |
| 71 | Ga0466720_180472 | 3300042607 | Bacteria | 1547 |
| 72 | Ga0466721_402319 | 3300042608 | Bacteria | 1820 |
| 73 | Ga0466722_094174 | 3300042609 | Bacteria | 17191 |
| 74 | JGI24698J34947_10000869 | 3300002449 | Bacteria | 15238 |
| 75 | JGI24698J34947_10007167 | 3300002449 | Bacteria | 6127 |
| 76 | JGI24698J34947_10007225 | 3300002449 | Bacteria | 6103 |
| 77 | JGI24698J34947_10021591 | 3300002449 | Bacteria | 3459 |
| 78 | Ga0068302_10106298 | 3300005071 | Bacteria | 2734 |
| 79 | Ga0072941_1153283 | 3300005201 | Bacteria | 2524 |
| 80 | Ga0466735_097398 | 3300042624 | Bacteria | 1586 |
| 81 | Ga0466709_241383 | 3300042648 | Bacteria | 9731 |
| 82 | Ga0466708_019718 | 3300042652 | Bacteria | 4629 |
| 83 | Ga0466708_049135 | 3300042652 | Bacteria | 6152 |
| 84 | Ga0466727_209185 | 3300042655 | Bacteria | 3426 |
| 85 | Ga0466705_275736 | 3300042612 | Bacteria | 3581 |
| 86 | Ga0123353_10497507 | 3300010167 | Bacteria | 1777 |
| 87 | Ga0123354_10337934 | 3300010882 | Bacteria | 1362 |
| 88 | Ga0466712_276705 | 3300042614 | Bacteria | 1227 |
| 89 | Ga0466715_037932 | 3300042616 | Bacteria | 49289 |
| 90 | Ga0466718_156391 | 3300042617 | Bacteria | 9739 |
| 91 | Ga0466723_358872 | 3300042618 | Bacteria | 4629 |
| 92 | Ga0466726_412452 | 3300042619 | Bacteria | 1895 |
| 93 | Ga0466728_295881 | 3300042620 | Bacteria | 18247 |
| 94 | Ga0466729_178881 | 3300042621 | Bacteria | 2917 |
| 95 | Ga0466690_400678 | 3300042590 | Bacteria | 2647 |
| 96 | Ga0466692_063216 | 3300042591 | Bacteria | 3496 |
| 97 | Ga0466694_153774 | 3300042594 | Bacteria | 1594 |
| 98 | Ga0466716_197339 | 3300042605 | Bacteria | 2444 |
| 99 | AustNasuHG_c1021036 | 3300000089 | Bacteria | 2117 |
| 100 | JGI24695J34938_10041613 | 3300002450 | Bacteria | 2062 |
| 101 | Ga0072941_1074299 | 3300005201 | Bacteria | 2614 |
| 102 | Ga0466703_025704 | 3300042636 | Bacteria | 95958 |
| 103 | Ga0466703_131027 | 3300042636 | Bacteria | 2481 |
| 104 | Ga0466703_318127 | 3300042636 | Bacteria | 2493 |
| 105 | Ga0466727_010059 | 3300042655 | Bacteria | 12059 |
| 106 | Ga0466727_074292 | 3300042655 | Bacteria | 1682 |
| 107 | Ga0466727_195003 | 3300042655 | Bacteria | 6162 |
| 108 | Ga0466705_005355 | 3300042612 | Bacteria | 12648 |
| 109 | Ga0466705_203426 | 3300042612 | Bacteria | 12940 |
| 110 | Ga0466733_004919 | 3300042659 | Bacteria | 1985 |
| 111 | Ga0466712_048935 | 3300042614 | Bacteria | 6271 |
| 112 | Ga0466711_075373 | 3300042615 | Bacteria | 27057 |
| 113 | Ga0466711_452483 | 3300042615 | Bacteria | 4287 |
| 114 | Ga0466723_043323 | 3300042618 | Bacteria | 23308 |
| 115 | Ga0466728_036752 | 3300042620 | Bacteria | 3982 |
| 116 | Ga0466728_122472 | 3300042620 | Bacteria | 2815 |
| 117 | Ga0264413_112494 | 3300024493 | Bacteria | 4000 |
| 118 | Ga0466691_015239 | 3300042593 | Bacteria | 10240 |
| 119 | Ga0466691_200114 | 3300042593 | Bacteria | 17588 |
| 120 | Ga0466694_173188 | 3300042594 | Bacteria | 2189 |
| 121 | Ga0466699_262886 | 3300042597 | Bacteria | 3918 |
| 122 | Ga0466703_079401 | 3300042636 | Bacteria | 4221 |
| 123 | Ga0466703_164185 | 3300042636 | Bacteria | 13810 |
| 124 | Ga0466704_153012 | 3300042643 | Bacteria | 54848 |
| 125 | Ga0466727_189288 | 3300042655 | Bacteria | 1328 |
| 126 | Ga0466705_084782 | 3300042612 | Bacteria | 24449 |
| 127 | Ga0466732_299776 | 3300042656 | Bacteria | 1917 |
| 128 | Ga0123353_10447637 | 3300010167 | Bacteria | 1903 |
| 129 | Ga0123354_10129489 | 3300010882 | Bacteria | 3197 |
| 130 | Ga0466712_259666 | 3300042614 | Bacteria | 1284 |
| 131 | Ga0466711_019592 | 3300042615 | Bacteria | 3693 |
| 132 | Ga0466711_364247 | 3300042615 | Bacteria | 2616 |
| 133 | Ga0466723_365927 | 3300042618 | Bacteria | 3222 |
| 134 | Ga0466692_036251 | 3300042591 | Bacteria | 1734 |
| 135 | Ga0466696_041928 | 3300042596 | Bacteria | 3096 |
| 136 | Ga0466699_420595 | 3300042597 | Bacteria | 1193 |
| 137 | Ga0466699_441937 | 3300042597 | Unclassified | 1834 |
| 138 | Ga0466719_011078 | 3300042606 | Bacteria | 4082 |
| 139 | Ga0466722_265261 | 3300042609 | Bacteria | 13661 |
| 140 | JGI24698J34947_10000035 | 3300002449 | Bacteria | 37551 |
| 141 | JGI24700J35501_10930826 | 3300002508 | Bacteria | 25995 |
| 142 | Ga0466703_059273 | 3300042636 | Bacteria | 6514 |
| 143 | Ga0466703_065065 | 3300042636 | Bacteria | 10516 |
| 144 | Ga0466709_226586 | 3300042648 | Bacteria | 1357 |
| 145 | Ga0466709_285745 | 3300042648 | Bacteria | 6318 |
| 146 | Ga0466708_137817 | 3300042652 | Bacteria | 1053 |
| 147 | Ga0466708_231552 | 3300042652 | Bacteria | 11100 |
| 148 | Ga0466727_128066 | 3300042655 | Bacteria | 2117 |
| 149 | Ga0466705_019218 | 3300042612 | Bacteria | 5585 |
| 150 | Ga0466705_080473 | 3300042612 | Bacteria | 1208 |
| 151 | Ga0466732_101831 | 3300042656 | Bacteria | 9208 |
| 152 | Ga0123357_10063583 | 3300009784 | Bacteria | 4935 |
| 153 | Ga0123353_10278755 | 3300010167 | Bacteria | 2569 |
| 154 | Ga0466726_188013 | 3300042619 | Bacteria | 2961 |
| 155 | Ga0466726_226051 | 3300042619 | Bacteria | 1467 |
| 156 | Ga0264413_121981 | 3300024493 | Bacteria | 3952 |
| 157 | Ga0456237_0003278 | 3300041968 | Bacteria | 2630 |
| 158 | Ga0466694_346929 | 3300042594 | Bacteria | 2252 |
| 159 | Ga0466707_006801 | 3300042601 | Bacteria | 9423 |
| 160 | Ga0466707_135155 | 3300042601 | Bacteria | 2692 |
| 161 | Ga0466707_265237 | 3300042601 | Bacteria | 1444 |
| 162 | Ga0466707_311419 | 3300042601 | Bacteria | 1072 |
| 163 | JGI24695J34938_10118233 | 3300002450 | Bacteria | 1079 |
| 164 | JGI24705J35276_12224728 | 3300002504 | Bacteria | 2641 |
| 165 | Ga0074263_107152 | 3300005485 | Bacteria | 2132 |
| 166 | Ga0074263_110497 | 3300005485 | Bacteria | 1895 |
| 167 | Ga0466704_151352 | 3300042643 | Bacteria | 18052 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF14833 | NAD_binding_11 | NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase | 181 | 301 | 0.99 |
| PF03446 | NAD_binding_2 | NAD binding domain of 6-phosphogluconate dehydrogenase | 20 | 178 | 0.98 |
| PF02826 | 2-Hacid_dh_C | D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain | 18 | 132 | 0.84 |
| PF03807 | F420_oxidored | NADP oxidoreductase coenzyme F420-dependent | 20 | 110 | 0.72 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF14833 | GO:0051287 | NAD binding | MF |
| PF03446 | GO:0050661 | NADP binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.