Protein Family IF04480
Metagenome
144
Members
39
Samples
144
Scaffolds
342.16
Avg Length
Representative Sequence
- ID
- 3300042590|Ga0466690_070162|Ga0466690_070162_5894_7135
- Length
- 396 aa
- Sequence
- LCSSFFFAKKLLFHIVRLENSCFSFNFTPIKNRKFIQMLNMESSKVYFTNLRTSSRSNLLDKMERLVNKAGLTTLELNKKFVAIKIHFGEPGNLAYLRPNYAARMANLLRQKGAKPFLTDSNTLYSGGRSNAVDHLQSAMENGYNPISAQCPVIIADGLKGTDYREIEFNGKYCKAPKIGAAIVDADVIVSMNHFKGHEQTGFGGALKNIGMGSASVGGKMELHSSSKPVITEDECRGCNICALHCAHNAIHLNADRIAEIDYAXXADYDTSEVLNCKIAEYTKAILDGKPHFHVNFIMNVSPECDCWNHNDAAIVPDIGIAASFDPVALDRACVDLVVRTPALPGSKLTESHREGINGQEDKFHLLHPDTNWQAGLDYAEELGIGTQEYELKEIG
Sample Types
Isolate
0.0%
Metagenome
100.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
35.9%
Kalotermitidae
33.3%
Termopsidae
10.3%
Unclassified
7.7%
Passalidae
5.1%
Rhinotermitidae
5.1%
Hodotermitidae
2.6%
Taxonomy
Archaea
0
Bacteria
136
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 2 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 3 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 4 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 5 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 6 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 7 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 8 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 9 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 10 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 11 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 12 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 13 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 14 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 15 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 16 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 17 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 18 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 19 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 20 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 21 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 22 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 23 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 24 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 25 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 26 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 27 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 28 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 29 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 30 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 31 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 32 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 33 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 34 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 35 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 36 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 37 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 38 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 39 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_294084 | 3300042612 | Bacteria | 7696 |
| 2 | Ga0466705_386007 | 3300042612 | Bacteria | 10413 |
| 3 | Ga0466733_222306 | 3300042659 | Bacteria | 1723 |
| 4 | Ga0466711_281334 | 3300042615 | Bacteria | 12036 |
| 5 | Ga0466728_017616 | 3300042620 | Bacteria | 14659 |
| 6 | Ga0466729_226489 | 3300042621 | Bacteria | 1941 |
| 7 | Ga0466703_106494 | 3300042636 | Bacteria | 2670 |
| 8 | Ga0466703_316316 | 3300042636 | Bacteria | 3182 |
| 9 | Ga0466706_179395 | 3300042599 | Bacteria | 1025 |
| 10 | Ga0466713_082847 | 3300042602 | Bacteria | 14596 |
| 11 | Ga0466713_107113 | 3300042602 | Bacteria | 1782 |
| 12 | Ga0466716_180048 | 3300042605 | Bacteria | 2804 |
| 13 | Ga0466716_291467 | 3300042605 | Bacteria | 1764 |
| 14 | IMNBL1DRAFT_c0008072 | 3300000062 | Bacteria | 5416 |
| 15 | Ga0123353_10104997 | 3300010167 | Bacteria | 4552 |
| 16 | Ga0466711_092222 | 3300042615 | Bacteria | 4026 |
| 17 | Ga0466711_423820 | 3300042615 | Bacteria | 15490 |
| 18 | Ga0466715_158674 | 3300042616 | Bacteria | 10773 |
| 19 | Ga0466723_089388 | 3300042618 | Bacteria | 4777 |
| 20 | Ga0466693_009343 | 3300042592 | Bacteria | 1241 |
| 21 | Ga0466691_070652 | 3300042593 | Bacteria | 38932 |
| 22 | Ga0466701_015189 | 3300042598 | Bacteria | 2047 |
| 23 | Ga0466703_188971 | 3300042636 | Bacteria | 4291 |
| 24 | Ga0466703_332216 | 3300042636 | Bacteria | 16803 |
| 25 | Ga0466727_294996 | 3300042655 | Bacteria | 11299 |
| 26 | Ga0466706_011591 | 3300042599 | Bacteria | 14693 |
| 27 | Ga0466706_162916 | 3300042599 | Bacteria | 6936 |
| 28 | Ga0466706_209165 | 3300042599 | Bacteria | 9936 |
| 29 | Ga0466716_499717 | 3300042605 | Bacteria | 7950 |
| 30 | Ga0466722_190914 | 3300042609 | Bacteria | 11284 |
| 31 | 2227103040 | 2225789004 | Bacteria | 1783 |
| 32 | JGI24702J35022_10104342 | 3300002462 | Bacteria | 1555 |
| 33 | Ga0466711_007694 | 3300042615 | Bacteria | 9756 |
| 34 | Ga0466715_018769 | 3300042616 | Bacteria | 7690 |
| 35 | Ga0466715_050653 | 3300042616 | Bacteria | 2436 |
| 36 | Ga0466723_244751 | 3300042618 | Bacteria | 7396 |
| 37 | Ga0466723_360712 | 3300042618 | Bacteria | 17034 |
| 38 | Ga0466696_104445 | 3300042596 | Bacteria | 5220 |
| 39 | Ga0466703_010111 | 3300042636 | Bacteria | 16936 |
| 40 | Ga0466704_179257 | 3300042643 | Bacteria | 5269 |
| 41 | Ga0466704_294860 | 3300042643 | Bacteria | 1341 |
| 42 | Ga0466704_316190 | 3300042643 | Unclassified | 9182 |
| 43 | Ga0466706_142891 | 3300042599 | Bacteria | 15328 |
| 44 | Ga0466706_236412 | 3300042599 | Bacteria | 28792 |
| 45 | Ga0466719_023432 | 3300042606 | Bacteria | 5979 |
| 46 | Ga0466719_574913 | 3300042606 | Bacteria | 2914 |
| 47 | Ga0068302_10044950 | 3300005071 | Bacteria | 1798 |
| 48 | Ga0068305_10025642 | 3300005083 | Bacteria | 5325 |
| 49 | Ga0466705_003446 | 3300042612 | Bacteria | 15410 |
| 50 | Ga0466733_204380 | 3300042659 | Bacteria | 28684 |
| 51 | Ga0466711_417850 | 3300042615 | Bacteria | 6071 |
| 52 | Ga0466723_219467 | 3300042618 | Bacteria | 13446 |
| 53 | Ga0415639_265304 | 3300038395 | Unclassified | 1244 |
| 54 | Ga0466656_211103 | 3300042550 | Bacteria | 2738 |
| 55 | Ga0466690_031105 | 3300042590 | Bacteria | 3006 |
| 56 | Ga0466690_070162 | 3300042590 | Bacteria | 9495 |
| 57 | Ga0466693_034399 | 3300042592 | Unclassified | 2057 |
| 58 | Ga0466693_128180 | 3300042592 | Bacteria | 1528 |
| 59 | Ga0466696_185779 | 3300042596 | Bacteria | 1505 |
| 60 | Ga0466709_041701 | 3300042648 | Bacteria | 32131 |
| 61 | Ga0466727_112528 | 3300042655 | Bacteria | 1700 |
| 62 | Ga0466727_273374 | 3300042655 | Bacteria | 6961 |
| 63 | Ga0466706_149496 | 3300042599 | Bacteria | 11511 |
| 64 | Ga0466719_219114 | 3300042606 | Bacteria | 4717 |
| 65 | Ga0466722_048871 | 3300042609 | Bacteria | 18842 |
| 66 | Ga0466697_049753 | 3300042611 | Bacteria | 1640 |
| 67 | JGI24702J35022_10000242 | 3300002462 | Bacteria | 31179 |
| 68 | Ga0466705_119653 | 3300042612 | Bacteria | 2440 |
| 69 | Ga0466705_358193 | 3300042612 | Bacteria | 48237 |
| 70 | Ga0123356_10130248 | 3300010049 | Bacteria | 2463 |
| 71 | Ga0123353_10140010 | 3300010167 | Bacteria | 3876 |
| 72 | Ga0466715_454534 | 3300042616 | Bacteria | 9177 |
| 73 | Ga0466718_132491 | 3300042617 | Bacteria | 1122 |
| 74 | Ga0466728_144965 | 3300042620 | Bacteria | 4745 |
| 75 | Ga0466696_178693 | 3300042596 | Bacteria | 5946 |
| 76 | Ga0466704_024785 | 3300042643 | Bacteria | 5574 |
| 77 | Ga0466704_027730 | 3300042643 | Bacteria | 11942 |
| 78 | Ga0466704_064913 | 3300042643 | Bacteria | 7599 |
| 79 | Ga0466704_233934 | 3300042643 | Bacteria | 27297 |
| 80 | Ga0466716_232262 | 3300042605 | Bacteria | 3894 |
| 81 | 2227538515 | 2225789004 | Bacteria | 15915 |
| 82 | Ga0466705_366592 | 3300042612 | Unclassified | 5917 |
| 83 | Ga0123354_10000021 | 3300010882 | Bacteria | 122100 |
| 84 | Ga0466715_026497 | 3300042616 | Bacteria | 11841 |
| 85 | Ga0466723_075931 | 3300042618 | Bacteria | 72847 |
| 86 | Ga0466723_351316 | 3300042618 | Bacteria | 2249 |
| 87 | Ga0466728_133087 | 3300042620 | Bacteria | 5086 |
| 88 | Ga0466728_324049 | 3300042620 | Bacteria | 45950 |
| 89 | Ga0466728_456796 | 3300042620 | Bacteria | 7991 |
| 90 | Ga0466690_224713 | 3300042590 | Bacteria | 5244 |
| 91 | Ga0466690_423485 | 3300042590 | Bacteria | 11428 |
| 92 | Ga0466703_180200 | 3300042636 | Bacteria | 19638 |
| 93 | Ga0466704_024389 | 3300042643 | Bacteria | 4898 |
| 94 | Ga0466704_193705 | 3300042643 | Bacteria | 13994 |
| 95 | Ga0466727_016314 | 3300042655 | Bacteria | 12921 |
| 96 | Ga0466727_123905 | 3300042655 | Bacteria | 5342 |
| 97 | Ga0466707_300769 | 3300042601 | Bacteria | 6332 |
| 98 | Ga0466713_002398 | 3300042602 | Bacteria | 5715 |
| 99 | Ga0466713_031099 | 3300042602 | Bacteria | 10373 |
| 100 | Ga0466719_196853 | 3300042606 | Unclassified | 1927 |
| 101 | Ga0466722_214336 | 3300042609 | Bacteria | 2451 |
| 102 | IMNBL1DRAFT_c0026441 | 3300000062 | Bacteria | 2203 |
| 103 | Ga0068305_10038920 | 3300005083 | Bacteria | 5212 |
| 104 | Ga0466732_299380 | 3300042656 | Bacteria | 1497 |
| 105 | Ga0466711_029873 | 3300042615 | Bacteria | 2676 |
| 106 | Ga0466711_209053 | 3300042615 | Bacteria | 8367 |
| 107 | Ga0466715_036852 | 3300042616 | Bacteria | 2471 |
| 108 | Ga0466715_448671 | 3300042616 | Bacteria | 9901 |
| 109 | Ga0466723_149113 | 3300042618 | Bacteria | 1228 |
| 110 | Ga0466726_021761 | 3300042619 | Bacteria | 4907 |
| 111 | Ga0466726_042905 | 3300042619 | Bacteria | 14115 |
| 112 | Ga0466690_020352 | 3300042590 | Bacteria | 4709 |
| 113 | Ga0466696_173693 | 3300042596 | Bacteria | 3066 |
| 114 | Ga0466735_023124 | 3300042624 | Bacteria | 3133 |
| 115 | Ga0466704_198945 | 3300042643 | Bacteria | 26642 |
| 116 | Ga0466704_364937 | 3300042643 | Bacteria | 10595 |
| 117 | Ga0466701_017343 | 3300042598 | Bacteria | 1426 |
| 118 | Ga0466713_011891 | 3300042602 | Bacteria | 19148 |
| 119 | Ga0466713_042940 | 3300042602 | Bacteria | 4212 |
| 120 | Ga0466716_243176 | 3300042605 | Bacteria | 10943 |
| 121 | JGI24702J35022_10010841 | 3300002462 | Bacteria | 5085 |
| 122 | JGI24702J35022_10098296 | 3300002462 | Unclassified | 1600 |
| 123 | Ga0068302_10063982 | 3300005071 | Bacteria | 3323 |
| 124 | Ga0068305_10034567 | 3300005083 | Bacteria | 2729 |
| 125 | Ga0466705_160446 | 3300042612 | Bacteria | 2435 |
| 126 | Ga0466705_168033 | 3300042612 | Bacteria | 2713 |
| 127 | Ga0123354_10101638 | 3300010882 | Bacteria | 3881 |
| 128 | Ga0466710_111045 | 3300042613 | Bacteria | 1960 |
| 129 | Ga0466715_152546 | 3300042616 | Bacteria | 5585 |
| 130 | Ga0466715_231386 | 3300042616 | Bacteria | 80319 |
| 131 | Ga0466728_152836 | 3300042620 | Bacteria | 9394 |
| 132 | Ga0466691_198184 | 3300042593 | Unclassified | 2585 |
| 133 | Ga0466691_208696 | 3300042593 | Bacteria | 12985 |
| 134 | Ga0466696_387414 | 3300042596 | Bacteria | 21871 |
| 135 | Ga0466696_429416 | 3300042596 | Bacteria | 3696 |
| 136 | Ga0466703_399651 | 3300042636 | Bacteria | 8975 |
| 137 | Ga0466709_283657 | 3300042648 | Bacteria | 2347 |
| 138 | Ga0466713_078158 | 3300042602 | Unclassified | 1732 |
| 139 | Ga0466713_079418 | 3300042602 | Bacteria | 8411 |
| 140 | Ga0466716_388133 | 3300042605 | Bacteria | 2212 |
| 141 | Ga0466719_151748 | 3300042606 | Bacteria | 10010 |
| 142 | Ga0466698_129485 | 3300042610 | Bacteria | 2075 |
| 143 | Ga0068302_10043882 | 3300005071 | Bacteria | 9975 |
| 144 | Ga0068302_10546900 | 3300005071 | Bacteria | 1931 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF04015 | DUF362 | Domain of unknown function (DUF362) | 82 | 336 | 0.97 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.