Protein Family IF04475
Metagenome
Isolate
291
Members
64
Samples
279
Scaffolds
285.27
Avg Length
Representative Sequence
- ID
- 3300042590|Ga0466690_050895|Ga0466690_050895_24_1043
- Length
- 339 aa
- Sequence
- LKRLSQNFSFWENNLRVSGKSGPLAAFSKAIPETNRVLGMALNASNKEFVYMAEVTAADVKKLREKTGAGMMECKNALVSSNGDFTAAERILKEKGLAAVEKRSGRAANEGKIFTKIKADGSRAVLLELASETDFVARNPEFISLGGAIGDRILEKGYTEINDELKGMVTELAAKIRENIGLKRIKTLNASPGEYLTQYIHGDGNIGVAVKLGADKEGAFANEDLRAFAFNIALHIAAFNPMALSREKIDSAWLKEQEDIFRKQMEQDEAMKGKPANVVDNILKGKVNKFLKDICLMDQGYVKDEKLTVAQALAEAGKKAGALISINEYAYYKVGSGDA
Sample Types
Isolate
4.1%
Metagenome
95.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
36.5%
Unclassified
23.8%
Kalotermitidae
22.2%
Rhinotermitidae
6.3%
Termopsidae
6.3%
Formicidae
3.2%
Hodotermitidae
1.6%
Taxonomy
Archaea
0
Bacteria
277
Eukaryota
0
Viruses
0
Unclassified
14
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 2 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 3 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 4 | 2781125691 | Treponema sp. Th196P3bin73 | Isolate | Unclassified |
| 5 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 6 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 7 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 8 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 9 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 10 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 11 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 12 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 13 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 14 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 15 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 16 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 17 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 18 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 19 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 20 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 21 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 22 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 23 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 24 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 25 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 26 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 27 | 2772190978 | Treponema sp. Nt197P3bin57 | Isolate | Unclassified |
| 28 | 2781125632 | Treponema sp. Co191P1bin87 | Isolate | Unclassified |
| 29 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 30 | 3300026545 | Army ant gut microbial communities from Eciton burchelli, Santa Rosa, Costa Rica - colony SREbp1 | Metagenome | Formicidae |
| 31 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 32 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 33 | 2781125639 | Treponema sp. Co191P1bin44 | Isolate | Unclassified |
| 34 | 2781125652 | Treponema sp. Cu122P5bin1 | Isolate | Unclassified |
| 35 | 2545824514 | Entomoplasma somnilux ATCC 49194 | Isolate | Unclassified |
| 36 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 37 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 38 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 39 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 40 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 41 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 42 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 43 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 44 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 45 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 46 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 47 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 48 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 49 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 50 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 51 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 52 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 53 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 54 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 55 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 56 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 57 | 2781125686 | Treponema sp. Lab288P4bin22 | Isolate | Unclassified |
| 58 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 59 | 3300026559 | Army ant gut microbial communities from Eciton burchelli, Santa Rosa, Costa Rica - colony SREbp2 | Metagenome | Formicidae |
| 60 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 61 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 62 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 63 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 64 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_165622 | 3300042612 | Bacteria | 4032 |
| 2 | Ga0466705_204310 | 3300042612 | Bacteria | 16863 |
| 3 | Ga0466732_331535 | 3300042656 | Bacteria | 2239 |
| 4 | Ga0466706_265738 | 3300042599 | Bacteria | 1445 |
| 5 | Ga0466700_474126 | 3300042600 | Bacteria | 1960 |
| 6 | Ga0466716_217031 | 3300042605 | Bacteria | 15553 |
| 7 | Ga0466719_032788 | 3300042606 | Unclassified | 1446 |
| 8 | Ga0466719_264379 | 3300042606 | Bacteria | 14167 |
| 9 | Ga0466719_445689 | 3300042606 | Bacteria | 3434 |
| 10 | Ga0466719_449018 | 3300042606 | Bacteria | 2129 |
| 11 | Ga0466698_494988 | 3300042610 | Bacteria | 1055 |
| 12 | Ga0466703_115044 | 3300042636 | Bacteria | 5974 |
| 13 | Ga0466709_383320 | 3300042648 | Bacteria | 3638 |
| 14 | Ga0466708_043659 | 3300042652 | Bacteria | 5056 |
| 15 | Ga0466708_093896 | 3300042652 | Bacteria | 20215 |
| 16 | Ga0466708_125821 | 3300042652 | Bacteria | 1120 |
| 17 | Ga0466708_133016 | 3300042652 | Bacteria | 45331 |
| 18 | Ga0466708_146826 | 3300042652 | Bacteria | 14862 |
| 19 | Ga0466727_337146 | 3300042655 | Bacteria | 1198 |
| 20 | Ga0466690_018680 | 3300042590 | Bacteria | 4610 |
| 21 | Ga0466693_327162 | 3300042592 | Bacteria | 1176 |
| 22 | Ga0466691_202107 | 3300042593 | Bacteria | 1736 |
| 23 | Ga0466694_060002 | 3300042594 | Bacteria | 7248 |
| 24 | Ga0123357_10191288 | 3300009784 | Bacteria | 2357 |
| 25 | Ga0123355_10378335 | 3300009826 | Bacteria | 1848 |
| 26 | Ga0123356_10002529 | 3300010049 | Bacteria | 19551 |
| 27 | Ga0123353_11399044 | 3300010167 | Bacteria | 899 |
| 28 | Ga0123354_10131181 | 3300010882 | Bacteria | 3164 |
| 29 | Ga0466705_499395 | 3300042612 | Bacteria | 13774 |
| 30 | Ga0466711_081719 | 3300042615 | Bacteria | 20511 |
| 31 | Ga0466715_181174 | 3300042616 | Bacteria | 1751 |
| 32 | Ga0466715_325051 | 3300042616 | Bacteria | 11282 |
| 33 | Ga0466723_166974 | 3300042618 | Bacteria | 22668 |
| 34 | Ga0466723_308116 | 3300042618 | Bacteria | 2476 |
| 35 | Ga0466726_007434 | 3300042619 | Bacteria | 2062 |
| 36 | Ga0466726_039892 | 3300042619 | Bacteria | 1955 |
| 37 | Ga0466726_308136 | 3300042619 | Bacteria | 20107 |
| 38 | Ga0466726_467573 | 3300042619 | Bacteria | 15546 |
| 39 | Ga0466728_111167 | 3300042620 | Bacteria | 15955 |
| 40 | JGI24698J34947_10002800 | 3300002449 | Bacteria | 9450 |
| 41 | Ga0072940_1142462 | 3300005200 | Bacteria | 1236 |
| 42 | Ga0123357_10002171 | 3300009784 | Bacteria | 21622 |
| 43 | Ga0466705_118518 | 3300042612 | Bacteria | 4025 |
| 44 | Ga0466705_203115 | 3300042612 | Bacteria | 8798 |
| 45 | Ga0466705_218722 | 3300042612 | Bacteria | 6733 |
| 46 | Ga0466706_146255 | 3300042599 | Bacteria | 2532 |
| 47 | Ga0466706_155109 | 3300042599 | Bacteria | 2299 |
| 48 | Ga0466707_139065 | 3300042601 | Bacteria | 1311 |
| 49 | Ga0466719_473072 | 3300042606 | Bacteria | 58828 |
| 50 | Ga0466704_435902 | 3300042643 | Bacteria | 11325 |
| 51 | Ga0466709_083921 | 3300042648 | Bacteria | 6460 |
| 52 | Ga0466709_194612 | 3300042648 | Bacteria | 25927 |
| 53 | Ga0466708_031998 | 3300042652 | Bacteria | 7393 |
| 54 | Ga0466708_103796 | 3300042652 | Bacteria | 41820 |
| 55 | Ga0255574_1004876 | 3300026545 | Bacteria | 65494 |
| 56 | Ga0255575_1000051 | 3300026559 | Bacteria | 365306 |
| 57 | Ga0415639_075255 | 3300038395 | Bacteria | 5714 |
| 58 | Ga0466690_318971 | 3300042590 | Bacteria | 1952 |
| 59 | Ga0466693_365247 | 3300042592 | Bacteria | 2179 |
| 60 | Ga0466691_024704 | 3300042593 | Bacteria | 6075 |
| 61 | Ga0466691_219202 | 3300042593 | Bacteria | 10145 |
| 62 | Ga0466694_285899 | 3300042594 | Bacteria | 5973 |
| 63 | Ga0466695_158964 | 3300042595 | Bacteria | 5318 |
| 64 | Ga0123355_10670121 | 3300009826 | Unclassified | 1203 |
| 65 | Ga0123353_10536535 | 3300010167 | Bacteria | 1692 |
| 66 | Ga0466712_141084 | 3300042614 | Unclassified | 9496 |
| 67 | Ga0466711_075218 | 3300042615 | Bacteria | 9191 |
| 68 | Ga0466711_095322 | 3300042615 | Bacteria | 5363 |
| 69 | Ga0466711_135361 | 3300042615 | Bacteria | 3329 |
| 70 | Ga0466711_342591 | 3300042615 | Bacteria | 80397 |
| 71 | Ga0466715_120929 | 3300042616 | Bacteria | 51611 |
| 72 | Ga0466715_157964 | 3300042616 | Bacteria | 15694 |
| 73 | Ga0466715_225667 | 3300042616 | Bacteria | 18003 |
| 74 | Ga0466726_007778 | 3300042619 | Bacteria | 7770 |
| 75 | Ga0466726_285306 | 3300042619 | Bacteria | 8323 |
| 76 | Ga0466726_363438 | 3300042619 | Bacteria | 1847 |
| 77 | Ga0466728_486896 | 3300042620 | Bacteria | 7316 |
| 78 | Ga0068302_10194190 | 3300005071 | Bacteria | 3390 |
| 79 | Ga0072941_1064105 | 3300005201 | Bacteria | 2069 |
| 80 | Ga0466707_255220 | 3300042601 | Bacteria | 1261 |
| 81 | Ga0466717_121149 | 3300042604 | Bacteria | 1254 |
| 82 | Ga0466716_090160 | 3300042605 | Bacteria | 16455 |
| 83 | Ga0466719_486595 | 3300042606 | Bacteria | 1364 |
| 84 | Ga0466731_395811 | 3300042622 | Bacteria | 1805 |
| 85 | Ga0466735_000841 | 3300042624 | Bacteria | 5005 |
| 86 | Ga0466703_061206 | 3300042636 | Bacteria | 11730 |
| 87 | Ga0466703_078236 | 3300042636 | Bacteria | 13855 |
| 88 | Ga0466704_046500 | 3300042643 | Bacteria | 45746 |
| 89 | Ga0466704_503011 | 3300042643 | Bacteria | 2930 |
| 90 | Ga0466709_022367 | 3300042648 | Bacteria | 18662 |
| 91 | Ga0466709_197117 | 3300042648 | Bacteria | 1976 |
| 92 | Ga0466709_261950 | 3300042648 | Bacteria | 34221 |
| 93 | Ga0466709_390342 | 3300042648 | Bacteria | 24495 |
| 94 | Ga0466708_040038 | 3300042652 | Bacteria | 6468 |
| 95 | Ga0466708_187629 | 3300042652 | Bacteria | 7619 |
| 96 | Ga0466727_305303 | 3300042655 | Bacteria | 3491 |
| 97 | Ga0255574_1004895 | 3300026545 | Bacteria | 11507 |
| 98 | Ga0466690_157976 | 3300042590 | Bacteria | 1742 |
| 99 | Ga0466691_079924 | 3300042593 | Bacteria | 2710 |
| 100 | Ga0466695_331421 | 3300042595 | Bacteria | 6642 |
| 101 | Ga0466699_108841 | 3300042597 | Bacteria | 2287 |
| 102 | Ga0123354_10373797 | 3300010882 | Bacteria | 1240 |
| 103 | Ga0466712_012516 | 3300042614 | Bacteria | 4183 |
| 104 | Ga0466712_173060 | 3300042614 | Bacteria | 15755 |
| 105 | Ga0466712_212989 | 3300042614 | Bacteria | 4839 |
| 106 | Ga0466715_438304 | 3300042616 | Bacteria | 15591 |
| 107 | Ga0466726_263148 | 3300042619 | Bacteria | 1598 |
| 108 | Ga0466728_025076 | 3300042620 | Bacteria | 15424 |
| 109 | JGI24698J34947_10062618 | 3300002449 | Unclassified | 1826 |
| 110 | JGI24705J35276_12222390 | 3300002504 | Bacteria | 2417 |
| 111 | Ga0072940_1183715 | 3300005200 | Unclassified | 1099 |
| 112 | Ga0466707_411569 | 3300042601 | Bacteria | 1144 |
| 113 | Ga0466716_207329 | 3300042605 | Bacteria | 2701 |
| 114 | Ga0466722_078420 | 3300042609 | Unclassified | 2699 |
| 115 | Ga0466729_255253 | 3300042621 | Bacteria | 2743 |
| 116 | Ga0466735_086167 | 3300042624 | Bacteria | 2167 |
| 117 | Ga0466703_188873 | 3300042636 | Bacteria | 7570 |
| 118 | Ga0466704_288422 | 3300042643 | Bacteria | 11514 |
| 119 | Ga0466704_587540 | 3300042643 | Bacteria | 8429 |
| 120 | Ga0466708_207996 | 3300042652 | Bacteria | 7306 |
| 121 | Ga0466692_083116 | 3300042591 | Bacteria | 14633 |
| 122 | Ga0466693_149905 | 3300042592 | Bacteria | 3767 |
| 123 | Ga0466694_141177 | 3300042594 | Bacteria | 2048 |
| 124 | Ga0466694_196889 | 3300042594 | Bacteria | 1590 |
| 125 | Ga0123355_10669908 | 3300009826 | Bacteria | 1203 |
| 126 | Ga0123353_10477863 | 3300010167 | Bacteria | 1824 |
| 127 | Ga0466705_475276 | 3300042612 | Bacteria | 13046 |
| 128 | Ga0466715_257116 | 3300042616 | Bacteria | 2546 |
| 129 | Ga0466715_303747 | 3300042616 | Bacteria | 3446 |
| 130 | Ga0466723_361425 | 3300042618 | Bacteria | 33931 |
| 131 | JGI24702J35022_10002425 | 3300002462 | Bacteria | 11383 |
| 132 | Ga0072941_1043696 | 3300005201 | Unclassified | 1647 |
| 133 | Ga0466705_073958 | 3300042612 | Bacteria | 25360 |
| 134 | Ga0466705_138025 | 3300042612 | Bacteria | 17830 |
| 135 | Ga0466705_273023 | 3300042612 | Bacteria | 6921 |
| 136 | Ga0466707_287046 | 3300042601 | Bacteria | 2696 |
| 137 | Ga0466713_028212 | 3300042602 | Bacteria | 5051 |
| 138 | Ga0466719_118931 | 3300042606 | Bacteria | 1927 |
| 139 | Ga0466722_035457 | 3300042609 | Bacteria | 25393 |
| 140 | Ga0466722_251290 | 3300042609 | Bacteria | 2607 |
| 141 | Ga0466722_257978 | 3300042609 | Unclassified | 4504 |
| 142 | Ga0466698_082695 | 3300042610 | Bacteria | 1521 |
| 143 | Ga0466729_243424 | 3300042621 | Bacteria | 1124 |
| 144 | Ga0466704_177537 | 3300042643 | Bacteria | 2531 |
| 145 | Ga0466704_527647 | 3300042643 | Bacteria | 2633 |
| 146 | Ga0466709_108611 | 3300042648 | Bacteria | 13737 |
| 147 | Ga0466709_261143 | 3300042648 | Bacteria | 5530 |
| 148 | Ga0466708_088164 | 3300042652 | Bacteria | 5012 |
| 149 | Ga0466708_104818 | 3300042652 | Bacteria | 10294 |
| 150 | Ga0466727_164251 | 3300042655 | Unclassified | 1021 |
| 151 | Ga0466727_206935 | 3300042655 | Bacteria | 2397 |
| 152 | Ga0466727_319192 | 3300042655 | Bacteria | 1583 |
| 153 | Ga0466690_050895 | 3300042590 | Bacteria | 2049 |
| 154 | Ga0466692_015318 | 3300042591 | Bacteria | 20491 |
| 155 | Ga0466691_099185 | 3300042593 | Bacteria | 2054 |
| 156 | Ga0466694_354682 | 3300042594 | Bacteria | 3230 |
| 157 | Ga0466696_063750 | 3300042596 | Bacteria | 11754 |
| 158 | Ga0466696_336694 | 3300042596 | Bacteria | 5085 |
| 159 | Ga0466696_450427 | 3300042596 | Bacteria | 17307 |
| 160 | Ga0123356_10997229 | 3300010049 | Bacteria | 1008 |
| 161 | Ga0123353_10006835 | 3300010167 | Bacteria | 15309 |
| 162 | Ga0466711_167765 | 3300042615 | Bacteria | 1740 |
| 163 | Ga0466715_249785 | 3300042616 | Bacteria | 7306 |
| 164 | Ga0466715_554640 | 3300042616 | Bacteria | 3721 |
| 165 | Ga0466723_185067 | 3300042618 | Bacteria | 1705 |
| 166 | Ga0466723_331635 | 3300042618 | Bacteria | 5570 |
| 167 | Ga0466726_113305 | 3300042619 | Bacteria | 2416 |
| 168 | Ga0072941_1001996 | 3300005201 | Bacteria | 50262 |
| 169 | Ga0466705_012096 | 3300042612 | Bacteria | 20668 |
| 170 | Ga0466705_357506 | 3300042612 | Bacteria | 14028 |
| 171 | Ga0466706_263068 | 3300042599 | Bacteria | 16427 |
| 172 | Ga0466700_458546 | 3300042600 | Bacteria | 2499 |
| 173 | Ga0466717_041174 | 3300042604 | Bacteria | 1591 |
| 174 | Ga0466716_094217 | 3300042605 | Bacteria | 10727 |
| 175 | Ga0466719_156344 | 3300042606 | Bacteria | 1204 |
| 176 | Ga0466719_218641 | 3300042606 | Bacteria | 6945 |
| 177 | Ga0466719_425589 | 3300042606 | Bacteria | 12270 |
| 178 | Ga0466722_200958 | 3300042609 | Bacteria | 5340 |
| 179 | Ga0466722_214297 | 3300042609 | Bacteria | 2430 |
| 180 | Ga0466722_221039 | 3300042609 | Bacteria | 1031 |
| 181 | Ga0466698_102621 | 3300042610 | Bacteria | 1345 |
| 182 | Ga0466698_201008 | 3300042610 | Bacteria | 2825 |
| 183 | Ga0466731_118134 | 3300042622 | Bacteria | 2221 |
| 184 | Ga0466703_024259 | 3300042636 | Bacteria | 18505 |
| 185 | Ga0466703_117146 | 3300042636 | Bacteria | 17491 |
| 186 | Ga0466703_152298 | 3300042636 | Unclassified | 1520 |
| 187 | Ga0466704_168830 | 3300042643 | Bacteria | 7731 |
| 188 | Ga0466704_245195 | 3300042643 | Bacteria | 4280 |
| 189 | Ga0466704_288984 | 3300042643 | Bacteria | 8672 |
| 190 | Ga0466708_125762 | 3300042652 | Bacteria | 1606 |
| 191 | Ga0466690_313579 | 3300042590 | Bacteria | 41778 |
| 192 | Ga0466692_010047 | 3300042591 | Bacteria | 7479 |
| 193 | Ga0466692_045595 | 3300042591 | Bacteria | 4665 |
| 194 | Ga0466691_116762 | 3300042593 | Bacteria | 30098 |
| 195 | Ga0466699_092978 | 3300042597 | Bacteria | 17484 |
| 196 | Ga0123354_10238031 | 3300010882 | Bacteria | 1881 |
| 197 | Ga0466712_194668 | 3300042614 | Bacteria | 3028 |
| 198 | Ga0466712_206430 | 3300042614 | Bacteria | 2143 |
| 199 | Ga0466711_257391 | 3300042615 | Bacteria | 2099 |
| 200 | Ga0466711_290578 | 3300042615 | Bacteria | 14399 |
| 201 | Ga0466715_007526 | 3300042616 | Bacteria | 13580 |
| 202 | Ga0466715_045794 | 3300042616 | Bacteria | 11420 |
| 203 | Ga0466715_274152 | 3300042616 | Bacteria | 5618 |
| 204 | Ga0466718_092489 | 3300042617 | Bacteria | 18817 |
| 205 | Ga0466723_082453 | 3300042618 | Bacteria | 72592 |
| 206 | Ga0466728_055598 | 3300042620 | Bacteria | 38254 |
| 207 | Ga0466728_160851 | 3300042620 | Bacteria | 2604 |
| 208 | Ga0072940_1183714 | 3300005200 | Unclassified | 1155 |
| 209 | Ga0466700_209015 | 3300042600 | Bacteria | 1592 |
| 210 | Ga0466719_130156 | 3300042606 | Bacteria | 2987 |
| 211 | Ga0466722_029238 | 3300042609 | Bacteria | 7846 |
| 212 | Ga0466703_149006 | 3300042636 | Bacteria | 17297 |
| 213 | Ga0466703_429093 | 3300042636 | Bacteria | 3772 |
| 214 | Ga0466704_063886 | 3300042643 | Bacteria | 26674 |
| 215 | Ga0466704_178142 | 3300042643 | Bacteria | 6680 |
| 216 | Ga0466709_214694 | 3300042648 | Bacteria | 1557 |
| 217 | Ga0466709_291599 | 3300042648 | Bacteria | 3822 |
| 218 | Ga0466709_366140 | 3300042648 | Bacteria | 2587 |
| 219 | Ga0466727_074740 | 3300042655 | Bacteria | 2664 |
| 220 | Ga0456237_0002420 | 3300041968 | Unclassified | 3018 |
| 221 | Ga0466690_152516 | 3300042590 | Bacteria | 2255 |
| 222 | Ga0466692_136964 | 3300042591 | Unclassified | 1144 |
| 223 | Ga0466691_075760 | 3300042593 | Bacteria | 16613 |
| 224 | Ga0466694_017172 | 3300042594 | Bacteria | 1294 |
| 225 | Ga0466694_082548 | 3300042594 | Bacteria | 2459 |
| 226 | Ga0466694_265729 | 3300042594 | Bacteria | 1536 |
| 227 | Ga0466696_052701 | 3300042596 | Bacteria | 10909 |
| 228 | Ga0123357_10021523 | 3300009784 | Bacteria | 8634 |
| 229 | Ga0466705_493643 | 3300042612 | Bacteria | 6740 |
| 230 | Ga0466712_037568 | 3300042614 | Bacteria | 7893 |
| 231 | Ga0466711_023947 | 3300042615 | Bacteria | 17367 |
| 232 | Ga0466711_108403 | 3300042615 | Bacteria | 1673 |
| 233 | Ga0466715_065478 | 3300042616 | Bacteria | 25951 |
| 234 | Ga0466715_163183 | 3300042616 | Bacteria | 22299 |
| 235 | Ga0466718_003976 | 3300042617 | Bacteria | 18604 |
| 236 | Ga0466723_013608 | 3300042618 | Bacteria | 12336 |
| 237 | Ga0466723_034530 | 3300042618 | Bacteria | 1496 |
| 238 | Ga0466726_343749 | 3300042619 | Bacteria | 2948 |
| 239 | JGI24698J34947_10000688 | 3300002449 | Bacteria | 16494 |
| 240 | JGI24698J34947_10043985 | 3300002449 | Bacteria | 2287 |
| 241 | JGI24695J34938_10024764 | 3300002450 | Bacteria | 2878 |
| 242 | Ga0072941_1004547 | 3300005201 | Bacteria | 8016 |
| 243 | Ga0072941_1006306 | 3300005201 | Bacteria | 12906 |
| 244 | Ga0466705_089854 | 3300042612 | Bacteria | 4411 |
| 245 | Ga0466713_142588 | 3300042602 | Bacteria | 3653 |
| 246 | Ga0466717_260518 | 3300042604 | Bacteria | 1231 |
| 247 | Ga0466716_234242 | 3300042605 | Bacteria | 1916 |
| 248 | Ga0466722_155137 | 3300042609 | Bacteria | 18198 |
| 249 | Ga0466704_367253 | 3300042643 | Bacteria | 1635 |
| 250 | Ga0466704_368636 | 3300042643 | Bacteria | 1792 |
| 251 | Ga0466709_295403 | 3300042648 | Bacteria | 2694 |
| 252 | Ga0456237_0000379 | 3300041968 | Bacteria | 6624 |
| 253 | Ga0466690_229483 | 3300042590 | Bacteria | 5441 |
| 254 | Ga0466690_361978 | 3300042590 | Bacteria | 3021 |
| 255 | Ga0466692_188850 | 3300042591 | Bacteria | 19216 |
| 256 | Ga0466691_012510 | 3300042593 | Bacteria | 4245 |
| 257 | Ga0466694_041059 | 3300042594 | Bacteria | 1937 |
| 258 | Ga0466695_043087 | 3300042595 | Bacteria | 1790 |
| 259 | Ga0466696_221912 | 3300042596 | Bacteria | 24962 |
| 260 | Ga0466699_160056 | 3300042597 | Bacteria | 2128 |
| 261 | Ga0466699_238713 | 3300042597 | Bacteria | 4810 |
| 262 | Ga0123353_10545596 | 3300010167 | Bacteria | 1674 |
| 263 | Ga0123353_10691080 | 3300010167 | Bacteria | 1434 |
| 264 | Ga0466712_051941 | 3300042614 | Bacteria | 37403 |
| 265 | Ga0466715_013077 | 3300042616 | Bacteria | 5369 |
| 266 | Ga0466715_097297 | 3300042616 | Bacteria | 8885 |
| 267 | Ga0466715_157935 | 3300042616 | Bacteria | 23735 |
| 268 | Ga0466715_333742 | 3300042616 | Bacteria | 1871 |
| 269 | Ga0466718_136549 | 3300042617 | Bacteria | 2462 |
| 270 | Ga0466723_070395 | 3300042618 | Bacteria | 6618 |
| 271 | AustNasuHG_c1009665 | 3300000089 | Bacteria | 3378 |
| 272 | JGI24698J34947_10000823 | 3300002449 | Bacteria | 15496 |
| 273 | JGI24698J34947_10002936 | 3300002449 | Bacteria | 9250 |
| 274 | JGI24698J34947_10026834 | 3300002449 | Bacteria | 3058 |
| 275 | JGI24698J34947_10041563 | 3300002449 | Bacteria | 2367 |
| 276 | JGI24698J34947_10050476 | 3300002449 | Bacteria | 2098 |
| 277 | JGI24702J35022_10003468 | 3300002462 | Bacteria | 9499 |
| 278 | Ga0068305_10032775 | 3300005083 | Unclassified | 4672 |
| 279 | Ga0072941_1001986 | 3300005201 | Bacteria | 25366 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00889 | EF_TS | Elongation factor TS | 124 | 335 | 0.95 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.