Protein Family IF04458
Metagenome
Isolate
110
Members
47
Samples
90
Scaffolds
370.79
Avg Length
Representative Sequence
- ID
- 3300042590|Ga0466690_026801|Ga0466690_026801_2150_3403
- Length
- 417 aa
- Sequence
- MRSLIFSILVLSLAACVAQDSLPLLDKAAFETTVDGRKTTLYTLKSGNGVIMQVTNFGARVISIWVPDKNGKYDDIAIGYENIDRYINNTGERFLGCVVGRYANRIAKGHFAIVDSTLNQGGRLSTLEVVEKRDENGNLISRDTLDMSKSLHTHSRVLSMHYQLPINNNGQTLHGGLKGLDMVVWDVKEASDTEIKFSYTSKDGDDGFPGNVTIDMTYTLTPQNEFRIDYQAVTDKSTVINLSNHTFFNLKGEANGTITDHILTINASHTTPVDSVLIPVGEIAPVDDTPFDFRKPTAIGERINLDNQQLKNGLGYDHNWVLDNTTGKVALAATLYEPVSGRVLEVYTDQPGLQFYSGNFFDGTYNGKYGKPIAFRETLALETQKFPDSPNHPNFPSTRLNPGETYTHTCIYRFLIK
Sample Types
Isolate
18.2%
Metagenome
81.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
29.8%
Unclassified
14.9%
Termitidae
12.8%
Rhinotermitidae
10.6%
Armadillidiidae
8.5%
Blattidae
6.4%
Termopsidae
6.4%
Hydrophilidae
4.3%
Hodotermitidae
2.1%
Passalidae
2.1%
Apidae
2.1%
Taxonomy
Archaea
0
Bacteria
107
Eukaryota
0
Viruses
0
Unclassified
3
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 2 | 2820748953 | Unclassified Bacteroidetes Nt197P4bin17 | Isolate | Unclassified |
| 3 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 4 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 5 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 6 | 2781125683 | Treponema sp. Lab288P1bin34 | Isolate | Unclassified |
| 7 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 8 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 9 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 10 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 11 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 12 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 13 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 14 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 15 | 2820781750 | Unclassified Bacteroidetes Emb289P3bin89 | Isolate | Unclassified |
| 16 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 17 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 18 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 19 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 20 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 21 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 22 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 23 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 24 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 25 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 26 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 27 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 28 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 29 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 30 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 31 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 32 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 33 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 34 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 35 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 36 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 37 | 8065497608 | Tellurirhabdus bombi IE-0392 | Isolate | Apidae |
| 38 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 39 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 40 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 41 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 42 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 43 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 44 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 45 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 46 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 47 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_044535 | 3300042659 | Bacteria | 127501 |
| 2 | Ga0466733_056399 | 3300042659 | Bacteria | 4736 |
| 3 | Ga0466708_366709 | 3300042652 | Bacteria | 24882 |
| 4 | Ga0466727_275937 | 3300042655 | Bacteria | 2557 |
| 5 | Ga0466713_051288 | 3300042602 | Bacteria | 230715 |
| 6 | Ga0466713_053726 | 3300042602 | Bacteria | 131027 |
| 7 | Ga0466719_319450 | 3300042606 | Bacteria | 13197 |
| 8 | Ga0466722_150639 | 3300042609 | Bacteria | 7694 |
| 9 | Ga0160456_100116 | 3300012820 | Bacteria | 82604 |
| 10 | Ga0456237_0001907 | 3300041968 | Unclassified | 3362 |
| 11 | Ga0466692_098779 | 3300042591 | Bacteria | 3863 |
| 12 | Ga0466710_269956 | 3300042613 | Bacteria | 2907 |
| 13 | Ga0466715_014882 | 3300042616 | Bacteria | 29632 |
| 14 | Ga0466723_064574 | 3300042618 | Bacteria | 7056 |
| 15 | Ga0466704_334247 | 3300042643 | Bacteria | 5681 |
| 16 | Ga0466709_200595 | 3300042648 | Bacteria | 11830 |
| 17 | Ga0466709_390589 | 3300042648 | Bacteria | 49108 |
| 18 | Ga0466706_023510 | 3300042599 | Bacteria | 42194 |
| 19 | Ga0466707_354135 | 3300042601 | Bacteria | 2429 |
| 20 | Ga0466713_112609 | 3300042602 | Bacteria | 21903 |
| 21 | Ga0466716_105025 | 3300042605 | Bacteria | 6430 |
| 22 | Ga0466716_315422 | 3300042605 | Bacteria | 2648 |
| 23 | Ga0466719_083337 | 3300042606 | Bacteria | 2361 |
| 24 | Ga0466690_028914 | 3300042590 | Bacteria | 8668 |
| 25 | Ga0466696_144382 | 3300042596 | Bacteria | 9452 |
| 26 | Ga0466711_103583 | 3300042615 | Bacteria | 8624 |
| 27 | Ga0466711_388602 | 3300042615 | Bacteria | 12898 |
| 28 | Ga0466723_313196 | 3300042618 | Bacteria | 7133 |
| 29 | Ga0466726_445903 | 3300042619 | Bacteria | 1623 |
| 30 | Ga0466735_085652 | 3300042624 | Bacteria | 4832 |
| 31 | Ga0466727_052508 | 3300042655 | Bacteria | 7468 |
| 32 | Ga0123354_10005162 | 3300010882 | Bacteria | 18876 |
| 33 | Ga0123354_10308711 | 3300010882 | Bacteria | 1482 |
| 34 | Ga0466706_083615 | 3300042599 | Unclassified | 2412 |
| 35 | Ga0466722_094675 | 3300042609 | Bacteria | 6981 |
| 36 | Ga0466722_165491 | 3300042609 | Bacteria | 4502 |
| 37 | Ga0160433_101231 | 3300012846 | Bacteria | 7582 |
| 38 | Ga0466690_026801 | 3300042590 | Bacteria | 6137 |
| 39 | Ga0466692_023509 | 3300042591 | Bacteria | 2880 |
| 40 | Ga0466705_378213 | 3300042612 | Bacteria | 34876 |
| 41 | Ga0466711_334516 | 3300042615 | Bacteria | 25865 |
| 42 | Ga0466711_372941 | 3300042615 | Bacteria | 8997 |
| 43 | Ga0466723_071688 | 3300042618 | Bacteria | 16030 |
| 44 | Ga0466723_089276 | 3300042618 | Bacteria | 12504 |
| 45 | Ga0466726_052848 | 3300042619 | Bacteria | 9696 |
| 46 | Ga0466728_159045 | 3300042620 | Bacteria | 3341 |
| 47 | Ga0466729_253924 | 3300042621 | Bacteria | 4249 |
| 48 | Ga0466703_085844 | 3300042636 | Bacteria | 3928 |
| 49 | Ga0466703_102634 | 3300042636 | Bacteria | 6214 |
| 50 | Ga0466703_187956 | 3300042636 | Bacteria | 10003 |
| 51 | Ga0466708_041066 | 3300042652 | Bacteria | 12959 |
| 52 | Ga0466708_069504 | 3300042652 | Bacteria | 8479 |
| 53 | Ga0466727_294845 | 3300042655 | Bacteria | 1880 |
| 54 | Ga0466716_356299 | 3300042605 | Bacteria | 4199 |
| 55 | Ga0160457_1011466 | 3300012858 | Unclassified | 1255 |
| 56 | Ga0466690_165805 | 3300042590 | Bacteria | 4117 |
| 57 | Ga0466692_108411 | 3300042591 | Bacteria | 15895 |
| 58 | Ga0466705_506364 | 3300042612 | Bacteria | 6465 |
| 59 | Ga0466728_026829 | 3300042620 | Bacteria | 2216 |
| 60 | Ga0466728_308661 | 3300042620 | Bacteria | 23749 |
| 61 | Ga0123357_10015185 | 3300009784 | Bacteria | 10091 |
| 62 | Ga0466707_072171 | 3300042601 | Bacteria | 20367 |
| 63 | Ga0466719_006711 | 3300042606 | Bacteria | 13342 |
| 64 | Ga0466719_228253 | 3300042606 | Bacteria | 1575 |
| 65 | Ga0466722_267924 | 3300042609 | Bacteria | 6562 |
| 66 | Ga0466690_133773 | 3300042590 | Bacteria | 8840 |
| 67 | Ga0466715_042591 | 3300042616 | Bacteria | 14628 |
| 68 | Ga0466723_275943 | 3300042618 | Bacteria | 2391 |
| 69 | Ga0466726_428833 | 3300042619 | Bacteria | 3593 |
| 70 | Ga0466728_058128 | 3300042620 | Bacteria | 22542 |
| 71 | Ga0466708_082955 | 3300042652 | Bacteria | 55601 |
| 72 | Ga0466727_086906 | 3300042655 | Bacteria | 13101 |
| 73 | IMNBL1DRAFT_c0004891 | 3300000062 | Bacteria | 7863 |
| 74 | Ga0466691_144507 | 3300042593 | Bacteria | 2896 |
| 75 | Ga0466699_163440 | 3300042597 | Bacteria | 1281 |
| 76 | Ga0466715_173370 | 3300042616 | Bacteria | 6068 |
| 77 | Ga0466735_075608 | 3300042624 | Bacteria | 2269 |
| 78 | Ga0466703_194864 | 3300042636 | Bacteria | 11004 |
| 79 | Ga0160445_100135 | 3300012847 | Bacteria | 64427 |
| 80 | Ga0466690_008579 | 3300042590 | Bacteria | 25173 |
| 81 | Ga0466692_046951 | 3300042591 | Bacteria | 32415 |
| 82 | Ga0466695_381322 | 3300042595 | Bacteria | 1512 |
| 83 | Ga0466715_200425 | 3300042616 | Bacteria | 12006 |
| 84 | Ga0466715_298373 | 3300042616 | Bacteria | 35320 |
| 85 | Ga0466735_005040 | 3300042624 | Bacteria | 4201 |
| 86 | Ga0466703_023372 | 3300042636 | Bacteria | 7055 |
| 87 | Ga0466703_285101 | 3300042636 | Bacteria | 3936 |
| 88 | Ga0466704_463254 | 3300042643 | Bacteria | 5866 |
| 89 | IMNBL1DRAFT_c0011919 | 3300000062 | Bacteria | 4018 |
| 90 | Ga0466696_270387 | 3300042596 | Bacteria | 17241 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01263 | Aldose_epim | Aldose 1-epimerase | 161 | 413 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.