Protein Family IF04445
Metagenome
Isolate
171
Members
48
Samples
165
Scaffolds
337.23
Avg Length
Representative Sequence
- ID
- 3300042590|Ga0466690_007234|Ga0466690_007234_284_1378
- Length
- 352 aa
- Sequence
- MLKRARACKIKKVAAICGKYILWRKMMKRVLVIALTLTVAFGTVLFAGGKQAGGGNVHAVVFKSTGNPFGEKLMDGFETGVKEQGGTVVRRAPDLPTAEAQIQIIDQLIAQKVASITISANDFDALQPVLTKAKNAGIKIVTADSAVNPASRSVHINQADTKGIGEILVEAAFDQAGGASNQNAWIAVMEETLKQPKYANLKLVKIAYGDDLRDKSVSETEGLLASYPNLKVIVAPTTVGIAAAAKVISDRGLIGKVKITGLGLPSEMAEYISNGSCPYMFLWNPIDLGYLASYAAGALSSGTITGKTGDKFDGGKLGGYTVVQSGDGGTEVILGPPFKFEPSNINEWKSVY
Sample Types
Isolate
2.9%
Metagenome
97.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
40.4%
Kalotermitidae
29.8%
Unclassified
12.8%
Rhinotermitidae
8.5%
Termopsidae
6.4%
Passalidae
2.1%
Taxonomy
Archaea
1
Bacteria
162
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 7 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 8 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 9 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 10 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 11 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 12 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 13 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 14 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 15 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 16 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 17 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 18 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 19 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 20 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 21 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 22 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 23 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 24 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 25 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 26 | 2781125656 | Treponema sp. Emb289P1bin65 | Isolate | Unclassified |
| 27 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 28 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 29 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 30 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 31 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 32 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 33 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 34 | 2772190978 | Treponema sp. Nt197P3bin57 | Isolate | Unclassified |
| 35 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 36 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 37 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 38 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 39 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 40 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 41 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 42 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 43 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 44 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 45 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 46 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 47 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 48 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_247175 | 3300042612 | Bacteria | 6140 |
| 2 | Ga0466705_348785 | 3300042612 | Bacteria | 46858 |
| 3 | Ga0466732_137461 | 3300042656 | Bacteria | 5460 |
| 4 | Ga0466732_227501 | 3300042656 | Bacteria | 3292 |
| 5 | Ga0466715_029661 | 3300042616 | Bacteria | 14479 |
| 6 | Ga0466715_117066 | 3300042616 | Bacteria | 10570 |
| 7 | Ga0466723_103142 | 3300042618 | Bacteria | 2090 |
| 8 | Ga0466726_308546 | 3300042619 | Bacteria | 3242 |
| 9 | Ga0466726_400479 | 3300042619 | Bacteria | 2116 |
| 10 | Ga0466726_490335 | 3300042619 | Bacteria | 2174 |
| 11 | Ga0264413_146090 | 3300024493 | Bacteria | 3040 |
| 12 | Ga0466690_003223 | 3300042590 | Bacteria | 10701 |
| 13 | Ga0466691_010979 | 3300042593 | Bacteria | 1658 |
| 14 | Ga0466691_023525 | 3300042593 | Bacteria | 1230 |
| 15 | Ga0466694_155148 | 3300042594 | Bacteria | 33595 |
| 16 | Ga0466694_392238 | 3300042594 | Bacteria | 3118 |
| 17 | Ga0466696_074360 | 3300042596 | Bacteria | 2054 |
| 18 | Ga0466703_332825 | 3300042636 | Bacteria | 6732 |
| 19 | Ga0466704_067639 | 3300042643 | Bacteria | 9444 |
| 20 | Ga0466708_073807 | 3300042652 | Bacteria | 5081 |
| 21 | Ga0466708_261348 | 3300042652 | Bacteria | 4884 |
| 22 | Ga0466708_292437 | 3300042652 | Bacteria | 2664 |
| 23 | Ga0466708_434283 | 3300042652 | Bacteria | 3576 |
| 24 | Ga0466727_014064 | 3300042655 | Bacteria | 1823 |
| 25 | Ga0466727_169332 | 3300042655 | Bacteria | 1976 |
| 26 | Ga0123356_10178524 | 3300010049 | Bacteria | 2143 |
| 27 | Ga0466716_004127 | 3300042605 | Bacteria | 19130 |
| 28 | Ga0466716_487633 | 3300042605 | Unclassified | 2831 |
| 29 | Ga0466722_185202 | 3300042609 | Bacteria | 2676 |
| 30 | JGI24702J35022_10068541 | 3300002462 | Bacteria | 1907 |
| 31 | JGI24705J35276_12226728 | 3300002504 | Bacteria | 2895 |
| 32 | Ga0072940_1011864 | 3300005200 | Bacteria | 4450 |
| 33 | Ga0466733_043680 | 3300042659 | Bacteria | 3645 |
| 34 | Ga0466733_084293 | 3300042659 | Bacteria | 10083 |
| 35 | Ga0466715_276095 | 3300042616 | Bacteria | 16435 |
| 36 | Ga0466715_337385 | 3300042616 | Bacteria | 28368 |
| 37 | Ga0466715_352368 | 3300042616 | Bacteria | 41831 |
| 38 | Ga0466723_005326 | 3300042618 | Bacteria | 6054 |
| 39 | Ga0466723_189959 | 3300042618 | Bacteria | 1638 |
| 40 | Ga0466723_257084 | 3300042618 | Bacteria | 3572 |
| 41 | Ga0466723_324243 | 3300042618 | Bacteria | 9461 |
| 42 | Ga0466728_059918 | 3300042620 | Bacteria | 2647 |
| 43 | Ga0466691_010385 | 3300042593 | Unclassified | 1759 |
| 44 | Ga0466691_142836 | 3300042593 | Bacteria | 24101 |
| 45 | Ga0466691_216648 | 3300042593 | Bacteria | 4893 |
| 46 | Ga0466729_295947 | 3300042621 | Bacteria | 2134 |
| 47 | Ga0466702_292629 | 3300042635 | Bacteria | 1471 |
| 48 | Ga0466703_104985 | 3300042636 | Archaea | 2489 |
| 49 | Ga0466703_126133 | 3300042636 | Bacteria | 1548 |
| 50 | Ga0466704_069544 | 3300042643 | Bacteria | 2885 |
| 51 | Ga0466709_123916 | 3300042648 | Unclassified | 1539 |
| 52 | Ga0466708_313738 | 3300042652 | Bacteria | 34279 |
| 53 | Ga0123355_10040946 | 3300009826 | Bacteria | 7542 |
| 54 | Ga0466719_126368 | 3300042606 | Bacteria | 8275 |
| 55 | Ga0466722_006745 | 3300042609 | Bacteria | 29004 |
| 56 | Ga0466722_046317 | 3300042609 | Bacteria | 10772 |
| 57 | Ga0466722_109095 | 3300042609 | Bacteria | 5639 |
| 58 | Ga0466722_152893 | 3300042609 | Bacteria | 2702 |
| 59 | Ga0466711_325368 | 3300042615 | Bacteria | 3524 |
| 60 | Ga0466718_007983 | 3300042617 | Bacteria | 11353 |
| 61 | Ga0466718_076924 | 3300042617 | Bacteria | 2028 |
| 62 | Ga0466723_157692 | 3300042618 | Bacteria | 11721 |
| 63 | Ga0466728_021024 | 3300042620 | Bacteria | 2933 |
| 64 | Ga0466728_188376 | 3300042620 | Bacteria | 2001 |
| 65 | Ga0456237_0000560 | 3300041968 | Bacteria | 5655 |
| 66 | Ga0466690_128140 | 3300042590 | Bacteria | 1953 |
| 67 | Ga0466691_054065 | 3300042593 | Bacteria | 2239 |
| 68 | Ga0466699_262438 | 3300042597 | Bacteria | 1355 |
| 69 | Ga0466703_062086 | 3300042636 | Bacteria | 35310 |
| 70 | Ga0466703_071234 | 3300042636 | Bacteria | 32935 |
| 71 | Ga0466703_083580 | 3300042636 | Bacteria | 4487 |
| 72 | Ga0466708_213967 | 3300042652 | Bacteria | 6760 |
| 73 | Ga0466708_332954 | 3300042652 | Bacteria | 1441 |
| 74 | Ga0466727_024233 | 3300042655 | Bacteria | 3718 |
| 75 | Ga0466701_034158 | 3300042598 | Bacteria | 2601 |
| 76 | Ga0466719_126527 | 3300042606 | Bacteria | 12884 |
| 77 | Ga0466715_210750 | 3300042616 | Bacteria | 13270 |
| 78 | Ga0466726_185739 | 3300042619 | Bacteria | 5905 |
| 79 | Ga0466726_326083 | 3300042619 | Bacteria | 9566 |
| 80 | Ga0466728_446107 | 3300042620 | Bacteria | 10681 |
| 81 | Ga0466690_014464 | 3300042590 | Bacteria | 11796 |
| 82 | Ga0466696_140273 | 3300042596 | Bacteria | 4532 |
| 83 | Ga0466696_392844 | 3300042596 | Bacteria | 1939 |
| 84 | Ga0466696_434531 | 3300042596 | Bacteria | 2827 |
| 85 | Ga0466703_099040 | 3300042636 | Bacteria | 5331 |
| 86 | Ga0466704_057799 | 3300042643 | Bacteria | 1564 |
| 87 | Ga0466704_268625 | 3300042643 | Bacteria | 59494 |
| 88 | Ga0466709_267702 | 3300042648 | Bacteria | 14355 |
| 89 | Ga0466727_287342 | 3300042655 | Unclassified | 1324 |
| 90 | Ga0123355_10003085 | 3300009826 | Bacteria | 23756 |
| 91 | AustNasuHG_c1000592 | 3300000089 | Bacteria | 12795 |
| 92 | JGI24698J34947_10005126 | 3300002449 | Bacteria | 7175 |
| 93 | JGI24702J35022_10001060 | 3300002462 | Bacteria | 17188 |
| 94 | JGI24700J35501_10930275 | 3300002508 | Bacteria | 12671 |
| 95 | Ga0466705_009255 | 3300042612 | Bacteria | 3589 |
| 96 | Ga0466705_020647 | 3300042612 | Bacteria | 15474 |
| 97 | Ga0466705_118528 | 3300042612 | Unclassified | 6202 |
| 98 | Ga0466705_474230 | 3300042612 | Bacteria | 3028 |
| 99 | Ga0466711_341793 | 3300042615 | Bacteria | 5155 |
| 100 | Ga0466718_110934 | 3300042617 | Bacteria | 3357 |
| 101 | Ga0466726_182054 | 3300042619 | Bacteria | 13107 |
| 102 | Ga0466691_021902 | 3300042593 | Bacteria | 3178 |
| 103 | Ga0466691_173328 | 3300042593 | Bacteria | 22529 |
| 104 | Ga0466691_175646 | 3300042593 | Bacteria | 4110 |
| 105 | Ga0466704_185777 | 3300042643 | Bacteria | 11287 |
| 106 | Ga0466708_193921 | 3300042652 | Bacteria | 1490 |
| 107 | Ga0466708_467196 | 3300042652 | Bacteria | 15542 |
| 108 | Ga0466727_302123 | 3300042655 | Bacteria | 2022 |
| 109 | Ga0466727_308455 | 3300042655 | Bacteria | 22441 |
| 110 | Ga0466716_061126 | 3300042605 | Bacteria | 6240 |
| 111 | Ga0072940_1049412 | 3300005200 | Bacteria | 2627 |
| 112 | Ga0466705_025406 | 3300042612 | Bacteria | 1140 |
| 113 | Ga0466705_068030 | 3300042612 | Bacteria | 27444 |
| 114 | Ga0466705_216735 | 3300042612 | Bacteria | 10484 |
| 115 | Ga0466691_012570 | 3300042593 | Bacteria | 32910 |
| 116 | Ga0466695_246466 | 3300042595 | Bacteria | 7313 |
| 117 | Ga0466735_050164 | 3300042624 | Bacteria | 20969 |
| 118 | Ga0466704_159641 | 3300042643 | Bacteria | 2626 |
| 119 | Ga0466704_430127 | 3300042643 | Bacteria | 30975 |
| 120 | Ga0466709_265960 | 3300042648 | Bacteria | 10518 |
| 121 | Ga0466708_246011 | 3300042652 | Bacteria | 47079 |
| 122 | Ga0466708_327322 | 3300042652 | Bacteria | 4193 |
| 123 | Ga0123356_10089402 | 3300010049 | Bacteria | 2930 |
| 124 | Ga0466716_320796 | 3300042605 | Bacteria | 1960 |
| 125 | Ga0466705_321082 | 3300042612 | Bacteria | 4628 |
| 126 | Ga0466711_309380 | 3300042615 | Bacteria | 9841 |
| 127 | Ga0466711_367078 | 3300042615 | Bacteria | 4888 |
| 128 | Ga0466711_512684 | 3300042615 | Bacteria | 9534 |
| 129 | Ga0466723_217029 | 3300042618 | Bacteria | 6535 |
| 130 | Ga0466728_335995 | 3300042620 | Bacteria | 4565 |
| 131 | Ga0466692_159472 | 3300042591 | Bacteria | 1866 |
| 132 | Ga0466691_040082 | 3300042593 | Unclassified | 5346 |
| 133 | Ga0466696_043350 | 3300042596 | Bacteria | 16584 |
| 134 | Ga0466703_039954 | 3300042636 | Bacteria | 32713 |
| 135 | Ga0466704_236505 | 3300042643 | Bacteria | 15020 |
| 136 | Ga0466704_338205 | 3300042643 | Bacteria | 4816 |
| 137 | Ga0466704_425485 | 3300042643 | Bacteria | 3403 |
| 138 | Ga0466709_053184 | 3300042648 | Bacteria | 1667 |
| 139 | Ga0466707_376109 | 3300042601 | Bacteria | 1443 |
| 140 | Ga0466714_096467 | 3300042603 | Bacteria | 14942 |
| 141 | Ga0466716_519839 | 3300042605 | Bacteria | 1571 |
| 142 | Ga0466719_061225 | 3300042606 | Bacteria | 1612 |
| 143 | Ga0466719_239229 | 3300042606 | Unclassified | 1909 |
| 144 | Ga0466719_310052 | 3300042606 | Bacteria | 1643 |
| 145 | Ga0466698_171573 | 3300042610 | Bacteria | 3109 |
| 146 | IMNBL1DRAFT_c0034815 | 3300000062 | Bacteria | 1785 |
| 147 | JGI24698J34947_10005927 | 3300002449 | Bacteria | 6703 |
| 148 | Ga0466705_220056 | 3300042612 | Bacteria | 5902 |
| 149 | Ga0466711_041135 | 3300042615 | Bacteria | 9157 |
| 150 | Ga0466711_097180 | 3300042615 | Bacteria | 4266 |
| 151 | Ga0466711_176014 | 3300042615 | Bacteria | 31697 |
| 152 | Ga0466711_293488 | 3300042615 | Bacteria | 6926 |
| 153 | Ga0466715_357043 | 3300042616 | Bacteria | 5307 |
| 154 | Ga0466715_378738 | 3300042616 | Bacteria | 5123 |
| 155 | Ga0466723_057705 | 3300042618 | Bacteria | 15524 |
| 156 | Ga0466728_315825 | 3300042620 | Unclassified | 2105 |
| 157 | Ga0466690_007234 | 3300042590 | Bacteria | 1493 |
| 158 | Ga0466692_048877 | 3300042591 | Bacteria | 18134 |
| 159 | Ga0466691_053406 | 3300042593 | Bacteria | 2199 |
| 160 | Ga0466735_058388 | 3300042624 | Bacteria | 11868 |
| 161 | Ga0466730_077064 | 3300042625 | Bacteria | 1120 |
| 162 | Ga0466709_006307 | 3300042648 | Bacteria | 4194 |
| 163 | Ga0466727_161476 | 3300042655 | Bacteria | 1408 |
| 164 | Ga0466727_196086 | 3300042655 | Bacteria | 1837 |
| 165 | Ga0466722_134165 | 3300042609 | Bacteria | 5465 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF13407 | Peripla_BP_4 | Periplasmic binding protein domain | 59 | 302 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.