Protein Family IF04328
Metagenome
Isolate
229
Members
68
Samples
199
Scaffolds
243.03
Avg Length
Representative Sequence
- ID
- 3300038395|Ga0415639_117847|Ga0415639_117847_466_1344
- Length
- 292 aa
- Sequence
- MAGHSKWSTIKRKKGEKDNARAKIFTKISREILVCIRENGSADPAVNGRLKDLITKAKSNNIPNDNIDRLLKKAQGGEKNDYESCTYEGYGPAGIAVLVSCLTDNRNRTAGEMRHYFDKYGGNLGTTGCVSFMFSEKGVVVVDNEEDEIDPDTFMEHVIEAGADDYSFEDGVIEVYTEANSAGKIAEGLTAHGYKILSAQNEQIPSTYTALSDTEQEEQIKKMTLLLEMLEDNDDVQNVWHNWXFPAAAAEFGAVGGLFVSAAGAEHFRRCCRTSAIAAEFSGIGSAALTSP
Sample Types
Isolate
13.1%
Metagenome
86.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
47.8%
Termitidae
29.9%
Kalotermitidae
13.4%
Passalidae
4.5%
Tenebrionidae
1.5%
Hodotermitidae
1.5%
Termopsidae
1.5%
Taxonomy
Archaea
0
Bacteria
210
Eukaryota
0
Viruses
0
Unclassified
19
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 2 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 3 | 2820339298 | Unclassified Firmicutes Nt197P3bin68 | Isolate | Unclassified |
| 4 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 5 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 6 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 7 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 8 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 9 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 10 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 11 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 12 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 13 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 14 | 2820373881 | Unclassified Firmicutes Nt197P3bin10 | Isolate | Unclassified |
| 15 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 16 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 17 | 2820242869 | Unclassified Firmicutes Th196P3bin82 | Isolate | Unclassified |
| 18 | 2820442516 | Unclassified Firmicutes Lab288P3bin200 | Isolate | Unclassified |
| 19 | 2820467504 | Unclassified Firmicutes Lab288P3bin1 | Isolate | Unclassified |
| 20 | 2820551407 | Unclassified Firmicutes Emb289P4bin38 | Isolate | Unclassified |
| 21 | 2820594669 | Unclassified Firmicutes Emb289P1bin61 | Isolate | Unclassified |
| 22 | 2820683647 | Unclassified Firmicutes Co191P1bin82 | Isolate | Unclassified |
| 23 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 24 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 25 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 26 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 27 | 2820246658 | Unclassified Firmicutes Th196P3bin70 | Isolate | Unclassified |
| 28 | 2820460928 | Unclassified Firmicutes Lab288P3bin140 | Isolate | Unclassified |
| 29 | 2820570671 | Unclassified Firmicutes Emb289P3bin19 | Isolate | Unclassified |
| 30 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 31 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 32 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 33 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 34 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 35 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 36 | 2820220859 | Unclassified Firmicutes Th196P4bin59 | Isolate | Unclassified |
| 37 | 2820265624 | Unclassified Firmicutes Th196P3bin36 | Isolate | Unclassified |
| 38 | 2820271343 | Unclassified Firmicutes Th196P3bin32 | Isolate | Unclassified |
| 39 | 2820288918 | Unclassified Firmicutes Th196P3bin137 | Isolate | Unclassified |
| 40 | 2820294436 | Unclassified Firmicutes Th196P3bin104 | Isolate | Unclassified |
| 41 | 2820387566 | Unclassified Firmicutes Nt197P1bin1 | Isolate | Unclassified |
| 42 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 43 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 44 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 45 | 2820244222 | Unclassified Firmicutes Th196P3bin75 | Isolate | Unclassified |
| 46 | 2820318056 | Unclassified Firmicutes Nt197P3bin94 | Isolate | Unclassified |
| 47 | 2820566695 | Unclassified Firmicutes Emb289P3bin50 | Isolate | Unclassified |
| 48 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 49 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 50 | 2820280018 | Unclassified Firmicutes Th196P3bin149 | Isolate | Unclassified |
| 51 | 2820707375 | Unclassified Firmicutes Co191P1bin31 | Isolate | Unclassified |
| 52 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 53 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 54 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 55 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 56 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 57 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 58 | 2820947865 | Unclassified Acidobacteria Nt197P3bin133 | Isolate | Unclassified |
| 59 | 2740892547 | Fibrobacteria bacterium GUT77 MC_77 | Isolate | Unclassified |
| 60 | 2820231849 | Unclassified Firmicutes Th196P4bin1 | Isolate | Unclassified |
| 61 | 2820255904 | Unclassified Firmicutes Th196P3bin48 | Isolate | Unclassified |
| 62 | 2820319488 | Unclassified Firmicutes Nt197P3bin88 | Isolate | Unclassified |
| 63 | 2820360414 | Unclassified Firmicutes Nt197P3bin121 | Isolate | Unclassified |
| 64 | 2820563109 | Unclassified Firmicutes Emb289P3bin58 | Isolate | Unclassified |
| 65 | 2820587002 | Unclassified Firmicutes Emb289P1bin94 | Isolate | Unclassified |
| 66 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 67 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 68 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123357_10190814 | 3300009784 | Bacteria | 2362 |
| 2 | Ga0123355_10304142 | 3300009826 | Bacteria | 2170 |
| 3 | Ga0123356_10000241 | 3300010049 | Bacteria | 62989 |
| 4 | Ga0123356_10000759 | 3300010049 | Bacteria | 35678 |
| 5 | Ga0123356_10000932 | 3300010049 | Bacteria | 32321 |
| 6 | Ga0123356_10025866 | 3300010049 | Bacteria | 5518 |
| 7 | Ga0123356_10043004 | 3300010049 | Bacteria | 4206 |
| 8 | Ga0123356_10084346 | 3300010049 | Unclassified | 3010 |
| 9 | Ga0123356_10245700 | 3300010049 | Bacteria | 1864 |
| 10 | Ga0123356_11080245 | 3300010049 | Bacteria | 971 |
| 11 | Ga0123356_11617493 | 3300010049 | Unclassified | 802 |
| 12 | Ga0123353_10113697 | 3300010167 | Bacteria | 4357 |
| 13 | Ga0123353_10228307 | 3300010167 | Bacteria | 2905 |
| 14 | Ga0123353_10350190 | 3300010167 | Bacteria | 2226 |
| 15 | Ga0123353_10501723 | 3300010167 | Bacteria | 1768 |
| 16 | Ga0466708_030595 | 3300042652 | Bacteria | 1055 |
| 17 | Ga0466706_107608 | 3300042599 | Bacteria | 10439 |
| 18 | Ga0466706_126055 | 3300042599 | Bacteria | 10485 |
| 19 | Ga0466706_131630 | 3300042599 | Bacteria | 11678 |
| 20 | Ga0466706_147182 | 3300042599 | Bacteria | 6606 |
| 21 | Ga0466706_281829 | 3300042599 | Bacteria | 79600 |
| 22 | Ga0466721_054780 | 3300042608 | Bacteria | 40923 |
| 23 | Ga0415639_022468 | 3300038395 | Bacteria | 3238 |
| 24 | Ga0415639_084366 | 3300038395 | Bacteria | 1482 |
| 25 | 2227627977 | 2225789004 | Bacteria | 2143 |
| 26 | JGI24702J35022_10000013 | 3300002462 | Bacteria | 68740 |
| 27 | Ga0123357_10027606 | 3300009784 | Bacteria | 7676 |
| 28 | Ga0123355_10229669 | 3300009826 | Bacteria | 2652 |
| 29 | Ga0123356_10003848 | 3300010049 | Bacteria | 15637 |
| 30 | Ga0123356_10007478 | 3300010049 | Bacteria | 10899 |
| 31 | Ga0123356_10320721 | 3300010049 | Bacteria | 1662 |
| 32 | Ga0123356_10333315 | 3300010049 | Bacteria | 1635 |
| 33 | Ga0123356_10336033 | 3300010049 | Bacteria | 1629 |
| 34 | Ga0123353_10385991 | 3300010167 | Bacteria | 2092 |
| 35 | Ga0123353_10738398 | 3300010167 | Unclassified | 1373 |
| 36 | Ga0123353_11050539 | 3300010167 | Bacteria | 1088 |
| 37 | Ga0466711_167586 | 3300042615 | Bacteria | 9419 |
| 38 | Ga0466715_451188 | 3300042616 | Bacteria | 6377 |
| 39 | Ga0466723_091214 | 3300042618 | Bacteria | 5329 |
| 40 | Ga0466702_131380 | 3300042635 | Bacteria | 61952 |
| 41 | Ga0466706_024005 | 3300042599 | Bacteria | 9471 |
| 42 | Ga0466706_114655 | 3300042599 | Bacteria | 31422 |
| 43 | Ga0466706_126139 | 3300042599 | Bacteria | 1003 |
| 44 | Ga0466706_147248 | 3300042599 | Bacteria | 20354 |
| 45 | Ga0415639_023942 | 3300038395 | Bacteria | 12096 |
| 46 | Ga0415639_028627 | 3300038395 | Bacteria | 8115 |
| 47 | Ga0466694_161681 | 3300042594 | Bacteria | 3372 |
| 48 | Ga0466699_060711 | 3300042597 | Bacteria | 1987 |
| 49 | JGI24695J34938_10024382 | 3300002450 | Bacteria | 2905 |
| 50 | Ga0068305_10004199 | 3300005083 | Unclassified | 1535 |
| 51 | Ga0123355_10083914 | 3300009826 | Bacteria | 5076 |
| 52 | Ga0123355_10296432 | 3300009826 | Bacteria | 2211 |
| 53 | Ga0123356_10014789 | 3300010049 | Bacteria | 7493 |
| 54 | Ga0123356_10016799 | 3300010049 | Bacteria | 6973 |
| 55 | Ga0123356_10049128 | 3300010049 | Bacteria | 3927 |
| 56 | Ga0123356_10077343 | 3300010049 | Bacteria | 3138 |
| 57 | Ga0123356_10084406 | 3300010049 | Bacteria | 3009 |
| 58 | Ga0123356_10097443 | 3300010049 | Bacteria | 2814 |
| 59 | Ga0123353_10045121 | 3300010167 | Bacteria | 6992 |
| 60 | Ga0123353_10156658 | 3300010167 | Bacteria | 3630 |
| 61 | Ga0123353_10281174 | 3300010167 | Bacteria | 2555 |
| 62 | Ga0123353_10941930 | 3300010167 | Bacteria | 1169 |
| 63 | Ga0123353_11050591 | 3300010167 | Bacteria | 1088 |
| 64 | Ga0466726_083133 | 3300042619 | Bacteria | 2996 |
| 65 | Ga0466706_079556 | 3300042599 | Bacteria | 28994 |
| 66 | Ga0466706_211304 | 3300042599 | Bacteria | 5717 |
| 67 | Ga0466720_039862 | 3300042607 | Bacteria | 56688 |
| 68 | Ga0466694_355937 | 3300042594 | Bacteria | 2652 |
| 69 | Ga0123355_10126303 | 3300009826 | Bacteria | 3952 |
| 70 | Ga0123355_10388394 | 3300009826 | Bacteria | 1811 |
| 71 | Ga0123356_10000021 | 3300010049 | Bacteria | 176996 |
| 72 | Ga0123356_10020606 | 3300010049 | Bacteria | 6235 |
| 73 | Ga0123356_10024729 | 3300010049 | Bacteria | 5649 |
| 74 | Ga0123356_10050040 | 3300010049 | Bacteria | 3890 |
| 75 | Ga0123356_10053962 | 3300010049 | Bacteria | 3742 |
| 76 | Ga0123353_10175956 | 3300010167 | Bacteria | 3393 |
| 77 | Ga0123353_10825964 | 3300010167 | Bacteria | 1275 |
| 78 | Ga0123353_11406239 | 3300010167 | Bacteria | 896 |
| 79 | Ga0466718_102257 | 3300042617 | Bacteria | 2439 |
| 80 | Ga0466702_464298 | 3300042635 | Bacteria | 1108 |
| 81 | Ga0466706_144282 | 3300042599 | Bacteria | 6317 |
| 82 | Ga0466698_283993 | 3300042610 | Bacteria | 2033 |
| 83 | Ga0415639_002563 | 3300038395 | Bacteria | 10321 |
| 84 | Ga0415639_004071 | 3300038395 | Bacteria | 25902 |
| 85 | 2226982325 | 2225789003 | Bacteria | 1902 |
| 86 | Ga0072940_1103497 | 3300005200 | Bacteria | 5178 |
| 87 | Ga0530661_000001 | 3300056564 | Bacteria | 684835 |
| 88 | Ga0123355_10000314 | 3300009826 | Bacteria | 62371 |
| 89 | Ga0123356_10000230 | 3300010049 | Bacteria | 65093 |
| 90 | Ga0123356_10000491 | 3300010049 | Bacteria | 44039 |
| 91 | Ga0123356_10161638 | 3300010049 | Bacteria | 2238 |
| 92 | Ga0123356_10222375 | 3300010049 | Bacteria | 1945 |
| 93 | Ga0123356_10692342 | 3300010049 | Bacteria | 1188 |
| 94 | Ga0123353_10000408 | 3300010167 | Bacteria | 53004 |
| 95 | Ga0123353_10005157 | 3300010167 | Bacteria | 17055 |
| 96 | Ga0123353_10034086 | 3300010167 | Bacteria | 7939 |
| 97 | Ga0123353_10290007 | 3300010167 | Bacteria | 2506 |
| 98 | Ga0123353_10735559 | 3300010167 | Bacteria | 1376 |
| 99 | Ga0466718_109556 | 3300042617 | Bacteria | 8157 |
| 100 | Ga0466702_438668 | 3300042635 | Bacteria | 1484 |
| 101 | Ga0466706_121875 | 3300042599 | Unclassified | 1238 |
| 102 | Ga0466706_255326 | 3300042599 | Bacteria | 15699 |
| 103 | Ga0466717_286622 | 3300042604 | Bacteria | 2610 |
| 104 | Ga0415639_117847 | 3300038395 | Bacteria | 2829 |
| 105 | IMNBL1DRAFT_c0002167 | 3300000062 | Unclassified | 13887 |
| 106 | JGI24698J34947_10000907 | 3300002449 | Bacteria | 15003 |
| 107 | JGI24695J34938_10084505 | 3300002450 | Unclassified | 1308 |
| 108 | JGI24702J35022_10063669 | 3300002462 | Bacteria | 1976 |
| 109 | Ga0123355_10000170 | 3300009826 | Bacteria | 79328 |
| 110 | Ga0123355_10000436 | 3300009826 | Bacteria | 54934 |
| 111 | Ga0123355_10358824 | 3300009826 | Bacteria | 1922 |
| 112 | Ga0123356_10002905 | 3300010049 | Bacteria | 18141 |
| 113 | Ga0123356_10018600 | 3300010049 | Bacteria | 6594 |
| 114 | Ga0123356_10019114 | 3300010049 | Bacteria | 6496 |
| 115 | Ga0123356_10033351 | 3300010049 | Bacteria | 4815 |
| 116 | Ga0123356_10057163 | 3300010049 | Bacteria | 3636 |
| 117 | Ga0123356_11210833 | 3300010049 | Bacteria | 921 |
| 118 | Ga0123356_11484755 | 3300010049 | Bacteria | 836 |
| 119 | Ga0123353_10092467 | 3300010167 | Bacteria | 4873 |
| 120 | Ga0123353_10142589 | 3300010167 | Bacteria | 3836 |
| 121 | Ga0123353_10145954 | 3300010167 | Bacteria | 3783 |
| 122 | Ga0466726_453884 | 3300042619 | Bacteria | 1335 |
| 123 | Ga0466703_257873 | 3300042636 | Bacteria | 13293 |
| 124 | Ga0466706_039128 | 3300042599 | Bacteria | 2226 |
| 125 | Ga0466706_140631 | 3300042599 | Unclassified | 1480 |
| 126 | Ga0466716_183734 | 3300042605 | Bacteria | 316127 |
| 127 | Ga0466721_301608 | 3300042608 | Bacteria | 3165 |
| 128 | Ga0415639_063315 | 3300038395 | Bacteria | 1401 |
| 129 | Ga0415639_162792 | 3300038395 | Bacteria | 1124 |
| 130 | Ga0123357_10000895 | 3300009784 | Bacteria | 30388 |
| 131 | Ga0123356_10000142 | 3300010049 | Bacteria | 81248 |
| 132 | Ga0123356_10006118 | 3300010049 | Bacteria | 12209 |
| 133 | Ga0123356_10007969 | 3300010049 | Bacteria | 10543 |
| 134 | Ga0123356_10009497 | 3300010049 | Bacteria | 9607 |
| 135 | Ga0123356_10017382 | 3300010049 | Bacteria | 6841 |
| 136 | Ga0123356_10081447 | 3300010049 | Bacteria | 3062 |
| 137 | Ga0123356_10092105 | 3300010049 | Bacteria | 2890 |
| 138 | Ga0123356_10150654 | 3300010049 | Bacteria | 2308 |
| 139 | Ga0123356_10279511 | 3300010049 | Bacteria | 1764 |
| 140 | Ga0123356_10888506 | 3300010049 | Bacteria | 1062 |
| 141 | Ga0123353_10003749 | 3300010167 | Bacteria | 19343 |
| 142 | Ga0123353_10050534 | 3300010167 | Bacteria | 6629 |
| 143 | Ga0123353_10080758 | 3300010167 | Bacteria | 5229 |
| 144 | Ga0123353_10229009 | 3300010167 | Bacteria | 2900 |
| 145 | Ga0123353_10565535 | 3300010167 | Bacteria | 1636 |
| 146 | Ga0123353_10901562 | 3300010167 | Unclassified | 1203 |
| 147 | Ga0123354_10177383 | 3300010882 | Bacteria | 2448 |
| 148 | Ga0466705_502014 | 3300042612 | Bacteria | 6584 |
| 149 | Ga0466715_615512 | 3300042616 | Bacteria | 4112 |
| 150 | Ga0466723_100716 | 3300042618 | Bacteria | 22662 |
| 151 | Ga0466702_007671 | 3300042635 | Bacteria | 1443 |
| 152 | Ga0466706_025980 | 3300042599 | Bacteria | 1637 |
| 153 | Ga0466706_141030 | 3300042599 | Unclassified | 2233 |
| 154 | Ga0466706_181127 | 3300042599 | Bacteria | 20737 |
| 155 | Ga0466706_203589 | 3300042599 | Bacteria | 8355 |
| 156 | Ga0466707_198266 | 3300042601 | Bacteria | 3473 |
| 157 | Ga0466716_092859 | 3300042605 | Bacteria | 2057 |
| 158 | Ga0466720_155111 | 3300042607 | Unclassified | 8799 |
| 159 | Ga0415639_007276 | 3300038395 | Unclassified | 2230 |
| 160 | Ga0466696_205002 | 3300042596 | Bacteria | 8702 |
| 161 | 2227535738 | 2225789004 | Bacteria | 55694 |
| 162 | JGI24695J34938_10031183 | 3300002450 | Bacteria | 2476 |
| 163 | JGI24702J35022_10000163 | 3300002462 | Bacteria | 34630 |
| 164 | JGI24703J35330_11748665 | 3300002501 | Bacteria | 24061 |
| 165 | Ga0072941_1367625 | 3300005201 | Bacteria | 2838 |
| 166 | Ga0466705_315599 | 3300042612 | Bacteria | 222244 |
| 167 | Ga0123357_10106228 | 3300009784 | Bacteria | 3600 |
| 168 | Ga0123355_10045591 | 3300009826 | Bacteria | 7131 |
| 169 | Ga0123355_10391176 | 3300009826 | Bacteria | 1802 |
| 170 | Ga0123356_10000740 | 3300010049 | Bacteria | 36026 |
| 171 | Ga0123356_10040602 | 3300010049 | Bacteria | 4335 |
| 172 | Ga0123356_10329519 | 3300010049 | Bacteria | 1643 |
| 173 | Ga0123356_10392762 | 3300010049 | Bacteria | 1523 |
| 174 | Ga0123356_10791970 | 3300010049 | Unclassified | 1119 |
| 175 | Ga0123356_11117278 | 3300010049 | Bacteria | 956 |
| 176 | Ga0123353_10030359 | 3300010167 | Bacteria | 8351 |
| 177 | Ga0123353_10184793 | 3300010167 | Unclassified | 3297 |
| 178 | Ga0123353_10265862 | 3300010167 | Unclassified | 2646 |
| 179 | Ga0123353_10434584 | 3300010167 | Unclassified | 1939 |
| 180 | Ga0123353_10500777 | 3300010167 | Bacteria | 1770 |
| 181 | Ga0123353_10786059 | 3300010167 | Bacteria | 1317 |
| 182 | Ga0123354_10031130 | 3300010882 | Bacteria | 8373 |
| 183 | Ga0466718_052477 | 3300042617 | Bacteria | 1611 |
| 184 | Ga0466706_033652 | 3300042599 | Bacteria | 26908 |
| 185 | Ga0466706_054025 | 3300042599 | Bacteria | 59903 |
| 186 | Ga0466706_167314 | 3300042599 | Bacteria | 7814 |
| 187 | Ga0466706_198371 | 3300042599 | Unclassified | 2291 |
| 188 | Ga0466706_212250 | 3300042599 | Bacteria | 9958 |
| 189 | Ga0466700_461794 | 3300042600 | Bacteria | 1083 |
| 190 | Ga0466719_251931 | 3300042606 | Bacteria | 2718 |
| 191 | Ga0466721_160358 | 3300042608 | Bacteria | 7071 |
| 192 | Ga0466721_259885 | 3300042608 | Unclassified | 6221 |
| 193 | Ga0415639_000326 | 3300038395 | Bacteria | 4695 |
| 194 | Ga0415639_011377 | 3300038395 | Bacteria | 8402 |
| 195 | Ga0415639_040587 | 3300038395 | Bacteria | 12097 |
| 196 | Ga0415639_075187 | 3300038395 | Bacteria | 2251 |
| 197 | Ga0415639_115616 | 3300038395 | Unclassified | 3283 |
| 198 | Ga0466699_231104 | 3300042597 | Bacteria | 4306 |
| 199 | Ga0072940_1043006 | 3300005200 | Bacteria | 8402 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.