Protein Family IF04317

Metagenome Isolate
199 Members
92 Samples
168 Scaffolds
226.18 Avg Length

🧬 Representative Sequence

ID
3300038395|Ga0415639_078812|Ga0415639_078812_322_1068
Length
248 aa
Sequence
LRAAKQLVVFCNIFDDFSFFLMATSQDLSFIYLISNASVPVQLVMALLVGVSVLSWMHIFRKRFAIRDAHIQTEAFEQSFWSGGNINSLYDRAGKNDRTGALERIFHAGMSEYIKGKPSSSISGTDVVALLDGARRAMRAAYQREMNNLESHLSFLASVGSVSPYVGLLGTVWGIMNAFRGLANVQQATLASVAPGIAEALIATAIGLFAAIPAVVAYNRFTYDVDRLAIRFESFIEEFSNILQRQTK

📊 Sample Types

Isolate 15.6%
Metagenome 84.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 22.7%
Termitidae 20.5%
Kalotermitidae 15.9%
Formicidae 10.2%
Elmidae 8.0%
Culicidae 4.5%
Termopsidae 4.5%
Rhinotermitidae 3.4%
Curculionidae 3.4%
Hydrophilidae 2.3%
Armadillidiidae 2.3%
Hodotermitidae 1.1%
Passalidae 1.1%

🌳 Taxonomy

Archaea 0
Bacteria 150
Eukaryota 0
Viruses 0
Unclassified 49

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2864826666 Acidovorax konjaci S00067 Isolate Elmidae
2 2873571580 Diaphorobacter sp. HDW4B Isolate Hydrophilidae
3 2820131053 Unclassified Proteobacteria Emb289P3bin8 Isolate Unclassified
4 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
5 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
6 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
7 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
8 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
9 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
10 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
11 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
12 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
13 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
14 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
15 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
16 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
17 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
18 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
19 2864870719 Comamonas odontotermitis S00124 Isolate Elmidae
20 2864937364 Acidovorax soli S00198 Isolate Elmidae
21 2891720358 Azoarcus nasutitermitis CC-YHH838 Isolate Unclassified
22 2820042117 Unclassified Proteobacteria Th196P4bin58 Isolate Unclassified
23 2820050117 Unclassified Proteobacteria Th196P3bin129 Isolate Unclassified
24 2820086750 Unclassified Proteobacteria Lab288P3bin98 Isolate Unclassified
25 2820157249 Unclassified Proteobacteria Cu122P4bin11 Isolate Unclassified
26 2820161938 Unclassified Proteobacteria Cu122P3bin14 Isolate Unclassified
27 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
28 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
29 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
30 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
31 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
32 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
33 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
34 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
35 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
36 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
37 2864960361 Comamonas odontotermitis S00229 Isolate Elmidae
38 2868169047 Comamonas aquatica S00077 Isolate Elmidae
39 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
40 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
41 3300012832 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG Metagenome Culicidae
42 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
43 8100461708 Delftia sp. S65 Isolate Curculionidae
44 2820062699 Unclassified Proteobacteria Nt197P4bin15 Isolate Unclassified
45 2820071837 Unclassified Proteobacteria Nt197P3bin132 Isolate Unclassified
46 2820077244 Unclassified Proteobacteria Lab288P4bin72 Isolate Unclassified
47 2820152154 Unclassified Proteobacteria Cu122P5bin47 Isolate Unclassified
48 3300007067 Ant gut microbial communities from Cephalotes spinosus, Peru Metagenome Formicidae
49 3300012820 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG Metagenome Armadillidiidae
50 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
51 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
52 8100449422 Delftia sp. S66 Isolate Curculionidae
53 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
54 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
55 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
56 3300012828 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG Metagenome
57 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
58 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
59 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
60 2864755708 Massilia timonae S00006 Isolate Elmidae
61 2820065746 Unclassified Proteobacteria Nt197P3bin56 Isolate Unclassified
62 2820084079 Unclassified Proteobacteria Lab288P4bin103 Isolate Unclassified
63 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
64 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
65 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
66 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
67 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
68 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
69 8100455565 Delftia sp. S67 Isolate Curculionidae
70 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
71 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
72 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
73 2820121232 Unclassified Proteobacteria Emb289P4bin32 Isolate Unclassified
74 2820123897 Unclassified Proteobacteria Emb289P4bin18 Isolate Unclassified
75 2820164216 Unclassified Proteobacteria Cu122P1bin22 Isolate Unclassified
76 3300007141 Ant gut microbial communities from Cephalotes maculatus, Brazil Metagenome Formicidae
77 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
78 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
79 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
80 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
81 2864968865 Paucibacter oligotrophus S00239 Isolate Elmidae
82 2873565274 Diaphorobacter sp. HDW4A Isolate Hydrophilidae
83 2518285616 Brachymonas chironomi DSM 19884 Isolate Unclassified
84 2820089333 Unclassified Proteobacteria Lab288P3bin88 Isolate Unclassified
85 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
86 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
87 3300012803 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG Metagenome
88 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
89 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
90 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
91 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
92 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466657_048785 3300042582 Bacteria 2271
2 Ga0466657_233079 3300042582 Bacteria 1503
3 Ga0466690_277140 3300042590 Bacteria 18089
4 Ga0466696_088256 3300042596 Unclassified 1842
5 Ga0466696_190346 3300042596 Bacteria 2120
6 Ga0466696_257107 3300042596 Unclassified 1635
7 Ga0466723_111176 3300042618 Bacteria 10295
8 Ga0466726_023986 3300042619 Bacteria 4865
9 Ga0466728_351910 3300042620 Bacteria 1131
10 Ga0466701_064880 3300042598 Bacteria 86948
11 Ga0466716_241603 3300042605 Unclassified 4417
12 Ga0123356_10014978 3300010049 Bacteria 7440
13 Ga0123353_10005915 3300010167 Bacteria 16176
14 Ga0160465_103071 3300012803 Bacteria 3242
15 JGI24702J35022_10016849 3300002462 Bacteria 4002
16 CVPL010W_10000621 3300002931 Bacteria 39342
17 Ga0103266_1000031 3300007067 Bacteria 79302
18 Ga0102734_1045930 3300007129 Bacteria 1141
19 Ga0103267_1000190 3300007190 Bacteria 24187
20 Ga0103268_1018026 3300007192 Unclassified 1567
21 Ga0466735_050883 3300042624 Unclassified 1505
22 Ga0466708_202354 3300042652 Bacteria 12602
23 Ga0466725_220813 3300042654 Bacteria 1276
24 Ga0466725_297769 3300042654 Bacteria 2620
25 Ga0466696_025932 3300042596 Unclassified 2496
26 Ga0466710_356496 3300042613 Bacteria 3540
27 Ga0466717_068132 3300042604 Bacteria 12456
28 Ga0466717_134590 3300042604 Unclassified 3927
29 Ga0466719_230899 3300042606 Bacteria 11173
30 Ga0466722_040502 3300042609 Unclassified 3922
31 Ga0466722_144815 3300042609 Bacteria 9021
32 Ga0123356_10255475 3300010049 Bacteria 1833
33 Ga0123353_10046087 3300010167 Bacteria 6924
34 Ga0123353_10428124 3300010167 Bacteria 1958
35 Ga0123357_10000047 3300009784 Bacteria 99859
36 Ga0466734_108500 3300042623 Bacteria 10383
37 Ga0466704_253425 3300042643 Bacteria 13984
38 Ga0466724_03571 3300042649 Unclassified 2832
39 Ga0466724_16999 3300042649 Bacteria 89252
40 Ga0466724_35850 3300042649 Bacteria 120573
41 Ga0466705_265080 3300042612 Unclassified 2470
42 Ga0415639_078812 3300038395 Bacteria 2453
43 Ga0466657_209081 3300042582 Bacteria 14979
44 Ga0466693_358048 3300042592 Bacteria 2886
45 Ga0466691_042493 3300042593 Unclassified 5856
46 Ga0466691_057570 3300042593 Bacteria 15599
47 Ga0466696_500751 3300042596 Unclassified 1499
48 Ga0466711_193748 3300042615 Bacteria 5417
49 Ga0466711_510839 3300042615 Bacteria 3380
50 Ga0466729_006181 3300042621 Unclassified 2433
51 Ga0466701_045543 3300042598 Bacteria 20074
52 Ga0466701_045609 3300042598 Unclassified 5332
53 IMNBL1DRAFT_c0004656 3300000062 Unclassified 8140
54 Ga0102739_1007827 3300007095 Unclassified 1412
55 Ga0466734_100851 3300042623 Bacteria 8248
56 Ga0466734_153066 3300042623 Bacteria 1808
57 Ga0466735_057160 3300042624 Bacteria 1466
58 Ga0466730_013812 3300042625 Bacteria 185537
59 Ga0466703_029997 3300042636 Bacteria 82848
60 Ga0466725_276843 3300042654 Unclassified 1472
61 Ga0466725_459177 3300042654 Unclassified 1221
62 Ga0466697_189664 3300042611 Unclassified 1364
63 Ga0160472_106168 3300012839 Bacteria 1819
64 Ga0466692_053378 3300042591 Unclassified 5545
65 Ga0466696_083006 3300042596 Bacteria 3654
66 Ga0466701_008226 3300042598 Bacteria 8132
67 Ga0466710_032288 3300042613 Bacteria 10505
68 Ga0466710_071032 3300042613 Bacteria 1197
69 Ga0466711_234171 3300042615 Bacteria 2328
70 Ga0466711_412154 3300042615 Bacteria 79545
71 Ga0466715_056881 3300042616 Bacteria 19859
72 Ga0466707_237744 3300042601 Bacteria 15150
73 Ga0466722_132817 3300042609 Bacteria 7420
74 Ga0466722_161553 3300042609 Bacteria 1634
75 Ga0123354_10003467 3300010882 Bacteria 21796
76 Ga0123354_10030901 3300010882 Bacteria 8406
77 JGI24705J35276_12238703 3300002504 Bacteria 39951
78 Ga0103268_1000025 3300007192 Bacteria 63089
79 Ga0466730_007701 3300042625 Bacteria 130976
80 Ga0466703_039810 3300042636 Bacteria 7699
81 Ga0466704_491544 3300042643 Bacteria 3604
82 Ga0466709_249659 3300042648 Unclassified 1172
83 Ga0466725_076164 3300042654 Bacteria 10381
84 Ga0466725_230125 3300042654 Bacteria 55475
85 Ga0466727_097908 3300042655 Bacteria 5909
86 Ga0160456_103718 3300012820 Bacteria 2210
87 Ga0160472_104175 3300012839 Unclassified 2620
88 Ga0466657_147289 3300042582 Bacteria 48033
89 Ga0466657_173500 3300042582 Bacteria 1855
90 Ga0466710_018523 3300042613 Bacteria 58589
91 Ga0466715_260135 3300042616 Unclassified 4268
92 Ga0466726_349453 3300042619 Bacteria 14796
93 Ga0466707_034033 3300042601 Bacteria 21912
94 Ga0466717_029840 3300042604 Bacteria 6839
95 Ga0466719_448705 3300042606 Bacteria 2093
96 Ga0123356_10072475 3300010049 Bacteria 3236
97 Ga0123354_10186837 3300010882 Bacteria 2340
98 Ga0160466_104170 3300012809 Bacteria 2160
99 Ga0102735_1000125 3300007080 Bacteria 39616
100 Ga0102738_1001366 3300007141 Unclassified 3803
101 Ga0466734_010062 3300042623 Bacteria 31477
102 Ga0466703_051459 3300042636 Unclassified 2299
103 Ga0466704_107308 3300042643 Bacteria 3755
104 Ga0466724_27214 3300042649 Bacteria 319260
105 Ga0466725_187630 3300042654 Unclassified 20718
106 Ga0466725_202271 3300042654 Unclassified 5340
107 Ga0466727_157864 3300042655 Bacteria 23797
108 Ga0466697_147928 3300042611 Bacteria 2223
109 Ga0466697_213049 3300042611 Unclassified 6391
110 Ga0466705_249690 3300042612 Unclassified 2037
111 Ga0466733_185417 3300042659 Bacteria 37806
112 Ga0160447_110312 3300012849 Bacteria 2061
113 Ga0160457_1010978 3300012858 Bacteria 1286
114 Ga0466657_056541 3300042582 Bacteria 144917
115 Ga0466705_415977 3300042612 Unclassified 3819
116 Ga0466710_086178 3300042613 Bacteria 11341
117 Ga0466729_053087 3300042621 Unclassified 5007
118 Ga0466706_058525 3300042599 Bacteria 3195
119 Ga0466707_102196 3300042601 Bacteria 53331
120 Ga0466717_068394 3300042604 Bacteria 2868
121 Ga0466717_296961 3300042604 Unclassified 3702
122 Ga0123356_10212874 3300010049 Unclassified 1983
123 Ga0123353_10000172 3300010167 Bacteria 82002
124 JGI24705J35276_12226044 3300002504 Unclassified 2801
125 Ga0072941_1257874 3300005201 Bacteria 1439
126 Ga0123357_10001474 3300009784 Bacteria 25016
127 Ga0466734_013399 3300042623 Bacteria 1463
128 Ga0466709_123452 3300042648 Bacteria 22742
129 Ga0466705_006413 3300042612 Bacteria 39277
130 Ga0160431_100014 3300012828 Unclassified 219889
131 Ga0160447_102335 3300012849 Unclassified 6712
132 Ga0466657_117791 3300042582 Bacteria 208686
133 Ga0466657_235543 3300042582 Unclassified 4354
134 Ga0466710_328451 3300042613 Bacteria 35241
135 Ga0466715_047103 3300042616 Unclassified 1636
136 Ga0466723_133614 3300042618 Bacteria 24457
137 Ga0466729_009085 3300042621 Bacteria 86734
138 Ga0466729_139576 3300042621 Bacteria 2531
139 Ga0466701_031875 3300042598 Bacteria 4066
140 Ga0466707_038566 3300042601 Bacteria 13336
141 Ga0466719_096188 3300042606 Bacteria 2085
142 Ga0466722_239292 3300042609 Bacteria 73982
143 Ga0123357_10266871 3300009784 Unclassified 1797
144 Ga0102734_1000245 3300007129 Bacteria 18180
145 Ga0102737_1000654 3300007142 Unclassified 11019
146 Ga0466734_130364 3300042623 Bacteria 3760
147 Ga0466724_28850 3300042649 Unclassified 7600
148 Ga0466725_019526 3300042654 Bacteria 20294
149 Ga0466725_198807 3300042654 Bacteria 9729
150 Ga0160470_101094 3300012813 Unclassified 7325
151 Ga0160458_100888 3300012832 Unclassified 8157
152 Ga0160447_115927 3300012849 Unclassified 1371
153 Ga0466657_249994 3300042582 Bacteria 28084
154 Ga0466693_410542 3300042592 Bacteria 3872
155 Ga0466691_115638 3300042593 Unclassified 1749
156 Ga0466715_609945 3300042616 Bacteria 50733
157 Ga0466701_044464 3300042598 Bacteria 300143
158 Ga0466701_054813 3300042598 Bacteria 1942
159 Ga0466713_010117 3300042602 Bacteria 24141
160 Ga0466716_160495 3300042605 Bacteria 2668
161 Ga0123353_10200665 3300010167 Bacteria 3138
162 Ga0123354_10000237 3300010882 Unclassified 49409
163 Ga0068302_10020993 3300005071 Bacteria 13774
164 Ga0466734_132786 3300042623 Bacteria 18612
165 Ga0466704_061300 3300042643 Bacteria 59338
166 Ga0466709_288613 3300042648 Unclassified 2094
167 Ga0466709_374643 3300042648 Unclassified 14882
168 Ga0466708_323177 3300042652 Unclassified 2153

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01618 MotA_ExbB MotA/TolQ/ExbB proton channel family 103 233 0.87

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.