Protein Family IF04295

Metagenome Isolate
172 Members
60 Samples
149 Scaffolds
88.38 Avg Length

🧬 Representative Sequence

ID
3300038395|Ga0415639_029443|Ga0415639_029443_2476_2787
Length
103 aa
Sequence
MGKIDKKSTKFGGKTVMFVKEVDVKNQVGLHARPATFFIQKANEYKSSIWVEKEERRVNAKSLLGILSLGIVEGSAIRIIADGTDEEQAVTGLVKLVESGFAE

📊 Sample Types

Isolate 13.4%
Metagenome 86.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 42.4%
Termitidae 33.9%
Kalotermitidae 11.9%
Passalidae 5.1%
Termopsidae 3.4%
Rhinotermitidae 1.7%
Hodotermitidae 1.7%

🌳 Taxonomy

Archaea 0
Bacteria 133
Eukaryota 0
Viruses 0
Unclassified 39

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820420508 Unclassified Firmicutes Lab288P3bin68 Isolate Unclassified
2 2820516196 Unclassified Firmicutes Lab288P1bin3 Isolate Unclassified
3 2820707375 Unclassified Firmicutes Co191P1bin31 Isolate Unclassified
4 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
5 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
6 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
7 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
8 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
9 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
10 2820373881 Unclassified Firmicutes Nt197P3bin10 Isolate Unclassified
11 2820424542 Unclassified Firmicutes Lab288P3bin47 Isolate Unclassified
12 2820464928 Unclassified Firmicutes Lab288P3bin121 Isolate Unclassified
13 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
14 2820255904 Unclassified Firmicutes Th196P3bin48 Isolate Unclassified
15 2820319488 Unclassified Firmicutes Nt197P3bin88 Isolate Unclassified
16 2820360414 Unclassified Firmicutes Nt197P3bin121 Isolate Unclassified
17 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
18 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
19 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
20 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
21 2820453354 Unclassified Firmicutes Lab288P3bin172 Isolate Unclassified
22 2820560510 Unclassified Firmicutes Emb289P3bin72 Isolate Unclassified
23 2820683647 Unclassified Firmicutes Co191P1bin82 Isolate Unclassified
24 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
25 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
26 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
27 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
28 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
29 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
30 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
31 2820265624 Unclassified Firmicutes Th196P3bin36 Isolate Unclassified
32 2820271343 Unclassified Firmicutes Th196P3bin32 Isolate Unclassified
33 2820288918 Unclassified Firmicutes Th196P3bin137 Isolate Unclassified
34 2820321184 Unclassified Firmicutes Nt197P3bin86 Isolate Unclassified
35 2820342392 Unclassified Firmicutes Nt197P3bin64 Isolate Unclassified
36 2820387566 Unclassified Firmicutes Nt197P1bin1 Isolate Unclassified
37 2820569216 Unclassified Firmicutes Emb289P3bin33 Isolate Unclassified
38 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
39 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
40 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
41 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
42 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
43 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
44 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
45 2820460928 Unclassified Firmicutes Lab288P3bin140 Isolate Unclassified
46 2820570671 Unclassified Firmicutes Emb289P3bin19 Isolate Unclassified
47 2820639607 Unclassified Firmicutes Cu122P5bin9 Isolate Unclassified
48 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
49 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
50 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
51 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
52 2820620956 Unclassified Firmicutes Emb289P1bin128 Isolate Unclassified
53 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
54 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
55 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
56 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
57 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
58 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
59 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
60 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466707_316581 3300042601 Bacteria 1336
2 Ga0466719_574195 3300042606 Unclassified 10634
3 Ga0466721_100978 3300042608 Bacteria 228571
4 Ga0466721_196001 3300042608 Bacteria 1036
5 Ga0466698_091188 3300042610 Bacteria 30334
6 Ga0415639_093209 3300038395 Unclassified 4271
7 Ga0466696_449998 3300042596 Bacteria 2185
8 2227316901 2225789004 Bacteria 6453
9 IMNBL1DRAFT_c0003630 3300000062 Bacteria 9759
10 IMNBL1DRAFT_c0128602 3300000062 Bacteria 661
11 Ga0123355_10060142 3300009826 Bacteria 6135
12 Ga0123356_10003762 3300010049 Bacteria 15811
13 Ga0123356_10208669 3300010049 Bacteria 2000
14 Ga0123356_10589589 3300010049 Bacteria 1275
15 Ga0123356_10698566 3300010049 Bacteria 1183
16 Ga0123353_10177230 3300010167 Bacteria 3379
17 Ga0123353_10519188 3300010167 Unclassified 1729
18 Ga0466714_010654 3300042603 Bacteria 1153
19 Ga0466733_044572 3300042659 Unclassified 6425
20 Ga0415639_060762 3300038395 Bacteria 10171
21 Ga0068305_10910429 3300005083 Bacteria 542
22 Ga0072940_1042442 3300005200 Bacteria 2258
23 Ga0123357_10107129 3300009784 Bacteria 3580
24 Ga0123357_10381917 3300009784 Bacteria 1306
25 Ga0123355_10222425 3300009826 Bacteria 2712
26 Ga0123355_10330414 3300009826 Bacteria 2043
27 Ga0123355_12205697 3300009826 Unclassified 503
28 Ga0123356_10316432 3300010049 Bacteria 1672
29 Ga0123356_13420009 3300010049 Bacteria 551
30 Ga0123353_10102925 3300010167 Bacteria 4603
31 Ga0123353_10890415 3300010167 Unclassified 1213
32 Ga0123354_10849649 3300010882 Unclassified 606
33 Ga0466706_114407 3300042599 Bacteria 65810
34 Ga0466697_115741 3300042611 Unclassified 1715
35 Ga0415639_007305 3300038395 Bacteria 17528
36 2227258876 2225789004 Bacteria 1303
37 2227526794 2225789004 Bacteria 645
38 IMNBL1DRAFT_c0023817 3300000062 Unclassified 2389
39 JGI24695J34938_10031234 3300002450 Bacteria 2473
40 Ga0072940_1202005 3300005200 Unclassified 1068
41 Ga0072941_1192741 3300005201 Bacteria 2086
42 Ga0466731_237210 3300042622 Unclassified 1038
43 Ga0466731_308279 3300042622 Unclassified 2347
44 Ga0123355_10221779 3300009826 Bacteria 2717
45 Ga0123356_10059459 3300010049 Bacteria 3565
46 Ga0123356_10085828 3300010049 Unclassified 2987
47 Ga0123353_10075698 3300010167 Bacteria 5408
48 Ga0123353_10980088 3300010167 Bacteria 1139
49 Ga0466706_198396 3300042599 Unclassified 1029
50 Ga0466706_244174 3300042599 Bacteria 79069
51 Ga0466707_136705 3300042601 Bacteria 3877
52 Ga0466714_006329 3300042603 Bacteria 1244
53 Ga0466717_052522 3300042604 Bacteria 1643
54 Ga0466722_128158 3300042609 Bacteria 7333
55 Ga0466698_002258 3300042610 Bacteria 5278
56 Ga0466733_192270 3300042659 Unclassified 1600
57 2227058159 2225789003 Unclassified 760
58 AustNasuHG_c1000967 3300000089 Unclassified 10347
59 JGI24695J34938_10259674 3300002450 Bacteria 740
60 Ga0466724_68956 3300042649 Bacteria 1027
61 Ga0123357_10373685 3300009784 Bacteria 1333
62 Ga0123355_10556638 3300009826 Bacteria 1383
63 Ga0123356_10000004 3300010049 Bacteria 279505
64 Ga0123356_10046321 3300010049 Bacteria 4045
65 Ga0123356_10831758 3300010049 Bacteria 1094
66 Ga0123356_11819870 3300010049 Bacteria 757
67 Ga0123356_12222163 3300010049 Unclassified 686
68 Ga0123353_10000031 3300010167 Bacteria 160211
69 Ga0123353_11066464 3300010167 Unclassified 1077
70 Ga0123353_11579424 3300010167 Bacteria 830
71 Ga0466706_107356 3300042599 Bacteria 1004
72 Ga0466706_256226 3300042599 Bacteria 2826
73 Ga0466716_430352 3300042605 Bacteria 2757
74 Ga0466721_317481 3300042608 Unclassified 3337
75 Ga0466733_073102 3300042659 Unclassified 4313
76 2227164125 2225789004 Bacteria 35735
77 JGI24703J35330_11748728 3300002501 Bacteria 29380
78 Ga0466702_032394 3300042635 Bacteria 34580
79 Ga0466725_468414 3300042654 Bacteria 1212
80 Ga0123356_11185701 3300010049 Bacteria 930
81 Ga0123356_11453105 3300010049 Bacteria 845
82 Ga0123353_10041558 3300010167 Bacteria 7265
83 Ga0123353_10197354 3300010167 Bacteria 3171
84 Ga0123353_10982564 3300010167 Bacteria 1137
85 Ga0123353_11427278 3300010167 Bacteria 888
86 Ga0123353_12003180 3300010167 Bacteria 709
87 Ga0123354_10890963 3300010882 Bacteria 585
88 Ga0466706_234385 3300042599 Unclassified 1790
89 Ga0466714_105020 3300042603 Unclassified 1652
90 Ga0466716_126908 3300042605 Bacteria 225387
91 Ga0466733_181311 3300042659 Unclassified 1689
92 Ga0415639_055402 3300038395 Bacteria 8753
93 Ga0415639_057494 3300038395 Unclassified 35152
94 2227267205 2225789004 Unclassified 1286
95 Ga0466727_005067 3300042655 Bacteria 9670
96 Ga0123355_10587514 3300009826 Unclassified 1328
97 Ga0123355_11425703 3300009826 Bacteria 682
98 Ga0123356_13623296 3300010049 Unclassified 534
99 Ga0123353_10132698 3300010167 Bacteria 3996
100 Ga0123353_11044855 3300010167 Bacteria 1092
101 Ga0123353_11489757 3300010167 Bacteria 863
102 Ga0123354_10271886 3300010882 Bacteria 1666
103 Ga0466706_006588 3300042599 Unclassified 1119
104 Ga0466706_108076 3300042599 Unclassified 1283
105 Ga0466706_113355 3300042599 Bacteria 10469
106 Ga0466706_165868 3300042599 Bacteria 1557
107 Ga0466706_259066 3300042599 Bacteria 2856
108 Ga0466706_281829 3300042599 Bacteria 79600
109 Ga0466733_102576 3300042659 Unclassified 3221
110 Ga0466733_108708 3300042659 Bacteria 11930
111 Ga0415639_001377 3300038395 Bacteria 23349
112 Ga0415639_006405 3300038395 Bacteria 33378
113 Ga0415639_029443 3300038395 Bacteria 3029
114 IMNBL1DRAFT_c0005760 3300000062 Bacteria 6975
115 IMNBL1DRAFT_c0016652 3300000062 Bacteria 3135
116 Ga0466735_100573 3300042624 Bacteria 1733
117 Ga0466702_395582 3300042635 Bacteria 1798
118 Ga0466704_129405 3300042643 Bacteria 91306
119 Ga0123355_10315152 3300009826 Bacteria 2115
120 Ga0123355_11858256 3300009826 Unclassified 565
121 Ga0123356_10266579 3300010049 Bacteria 1800
122 Ga0123356_10285054 3300010049 Bacteria 1749
123 Ga0123356_10352257 3300010049 Bacteria 1596
124 Ga0123356_10874435 3300010049 Unclassified 1070
125 Ga0123356_11415729 3300010049 Bacteria 855
126 Ga0123356_11455445 3300010049 Unclassified 844
127 Ga0123356_11586665 3300010049 Bacteria 810
128 Ga0123353_10029617 3300010167 Bacteria 8442
129 Ga0123353_10307792 3300010167 Unclassified 2414
130 Ga0123353_10688155 3300010167 Bacteria 1438
131 Ga0123353_13360789 3300010167 Bacteria 509
132 Ga0466706_067670 3300042599 Bacteria 6326
133 Ga0466706_262157 3300042599 Unclassified 1092
134 Ga0466707_140766 3300042601 Bacteria 2045
135 Ga0466721_069952 3300042608 Bacteria 1357
136 Ga0466721_242857 3300042608 Bacteria 3240
137 Ga0466690_167383 3300042590 Bacteria 43243
138 IMNBL1DRAFT_c0076176 3300000062 Unclassified 952
139 Ga0466715_327423 3300042616 Bacteria 71223
140 Ga0466728_059399 3300042620 Bacteria 40942
141 Ga0123355_10003620 3300009826 Bacteria 22255
142 Ga0123356_10002442 3300010049 Bacteria 19870
143 Ga0123356_10237409 3300010049 Unclassified 1892
144 Ga0123353_10000900 3300010167 Bacteria 36274
145 Ga0123353_10002202 3300010167 Bacteria 24122
146 Ga0123353_10132785 3300010167 Bacteria 3994
147 Ga0123353_10160663 3300010167 Bacteria 3577
148 Ga0123353_10386596 3300010167 Unclassified 2090
149 Ga0123353_10584205 3300010167 Bacteria 1602

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00381 PTS-HPr PTS HPr component phosphorylation site 20 98 0.97

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.