Protein Family IF04195
Metagenome
Isolate
175
Members
63
Samples
161
Scaffolds
236.81
Avg Length
Representative Sequence
- ID
- 3300024493|Ga0264413_148063|Ga0264413_1480635
- Length
- 247 aa
- Sequence
- MRLFCNIIGIVMKPVYNRVLLKLSGESLMGDKEFGIQSSVLQYFASEVAKVSMLGVQIGIVIGGGNIYRGVSDSSDKIDKVTGDYMGMLATVINALALQNSFEKEHLDTRLLTAIEMAEIAEPVIRRRALRHLEKKRIVIFGAGTGNPYFTTDTAAALRAVELQAEVILKGTRVDGIYDSDPEKNPNAKKYKTISYDQVLQNNLRVMDQTAITLCKENKLPILVFNMNEADNFKKIILGEELGTLVF
Sample Types
Isolate
8.0%
Metagenome
92.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
34.4%
Kalotermitidae
23.0%
Blattidae
9.8%
Unclassified
9.8%
Rhinotermitidae
8.2%
Apidae
3.3%
Passalidae
3.3%
Aphididae
3.3%
Termopsidae
3.3%
Hodotermitidae
1.6%
Taxonomy
Archaea
0
Bacteria
169
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 2 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 3 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 4 | 2785510743 | Apibacter sp. ESL0404 | Isolate | Apidae |
| 5 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 6 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 7 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 8 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 9 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 10 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 11 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 12 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 13 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 14 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 15 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 16 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 17 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 18 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 19 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 20 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 21 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 22 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 23 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 24 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 25 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 26 | 2832298047 | Apibacter sp. wkB309 | Isolate | Apidae |
| 27 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 28 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 29 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 30 | 2884499693 | Buchnera aphidicola BuCikochiana/2762 | Isolate | Aphididae |
| 31 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 32 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 33 | 643348524 | Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 | Isolate | Unclassified |
| 34 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 35 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 36 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 37 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 38 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 39 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 40 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 41 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 42 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 43 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 44 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 45 | 643348521 | Buchnera aphidicola Cc | Isolate | Aphididae |
| 46 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 47 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 48 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 49 | 2799112231 | Apibacter sp. ESL0432 | Isolate | Unclassified |
| 50 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 51 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 52 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 53 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 54 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 55 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 56 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 57 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 58 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 59 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 60 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 61 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 62 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 63 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_261044 | 3300042611 | Bacteria | 1482 |
| 2 | Ga0466733_189395 | 3300042659 | Bacteria | 4385 |
| 3 | Ga0123357_10017820 | 3300009784 | Bacteria | 9419 |
| 4 | Ga0123356_11036251 | 3300010049 | Bacteria | 990 |
| 5 | Ga0123353_10611151 | 3300010167 | Bacteria | 1555 |
| 6 | Ga0123354_10048971 | 3300010882 | Bacteria | 6416 |
| 7 | Ga0123354_10388880 | 3300010882 | Unclassified | 1195 |
| 8 | Ga0264413_148063 | 3300024493 | Bacteria | 4642 |
| 9 | Ga0466700_070609 | 3300042600 | Bacteria | 2986 |
| 10 | Ga0466713_026234 | 3300042602 | Bacteria | 17662 |
| 11 | Ga0466713_045654 | 3300042602 | Bacteria | 11902 |
| 12 | Ga0466714_013515 | 3300042603 | Bacteria | 22119 |
| 13 | Ga0466714_143384 | 3300042603 | Bacteria | 4447 |
| 14 | Ga0466717_135371 | 3300042604 | Bacteria | 1050 |
| 15 | Ga0466716_035492 | 3300042605 | Bacteria | 1060 |
| 16 | Ga0466719_257931 | 3300042606 | Bacteria | 3356 |
| 17 | Ga0466722_027738 | 3300042609 | Bacteria | 1469 |
| 18 | Ga0466735_060395 | 3300042624 | Bacteria | 1812 |
| 19 | Ga0466704_561838 | 3300042643 | Bacteria | 29338 |
| 20 | JGI24705J35276_12214172 | 3300002504 | Bacteria | 1950 |
| 21 | JGI24699J35502_11132808 | 3300002509 | Bacteria | 7670 |
| 22 | JGI24699J35502_11134093 | 3300002509 | Bacteria | 30011 |
| 23 | Ga0466733_083981 | 3300042659 | Bacteria | 6049 |
| 24 | Ga0123356_10129521 | 3300010049 | Bacteria | 2470 |
| 25 | Ga0123354_10009455 | 3300010882 | Bacteria | 14924 |
| 26 | Ga0123354_10015469 | 3300010882 | Bacteria | 11915 |
| 27 | Ga0466701_061816 | 3300042598 | Bacteria | 14165 |
| 28 | Ga0466707_263999 | 3300042601 | Bacteria | 16080 |
| 29 | Ga0466713_056151 | 3300042602 | Bacteria | 40882 |
| 30 | Ga0466713_082506 | 3300042602 | Bacteria | 5942 |
| 31 | Ga0466716_202648 | 3300042605 | Bacteria | 3767 |
| 32 | Ga0466716_467442 | 3300042605 | Bacteria | 25909 |
| 33 | Ga0466722_108530 | 3300042609 | Bacteria | 1990 |
| 34 | Ga0466734_098321 | 3300042623 | Bacteria | 1395 |
| 35 | Ga0466735_096323 | 3300042624 | Bacteria | 1889 |
| 36 | Ga0466703_348714 | 3300042636 | Bacteria | 36764 |
| 37 | Ga0466704_098763 | 3300042643 | Bacteria | 16759 |
| 38 | Ga0466727_311789 | 3300042655 | Bacteria | 6585 |
| 39 | Ga0068305_10321584 | 3300005083 | Bacteria | 7639 |
| 40 | Ga0123356_10173001 | 3300010049 | Bacteria | 2172 |
| 41 | Ga0123353_10675263 | 3300010167 | Bacteria | 1456 |
| 42 | Ga0466692_051369 | 3300042591 | Bacteria | 55044 |
| 43 | Ga0466696_289866 | 3300042596 | Bacteria | 18784 |
| 44 | Ga0466706_226772 | 3300042599 | Bacteria | 1298 |
| 45 | Ga0466700_086151 | 3300042600 | Bacteria | 2525 |
| 46 | Ga0466707_080227 | 3300042601 | Bacteria | 11157 |
| 47 | Ga0466707_208886 | 3300042601 | Bacteria | 2963 |
| 48 | Ga0466714_013813 | 3300042603 | Bacteria | 151010 |
| 49 | Ga0466714_033730 | 3300042603 | Bacteria | 7007 |
| 50 | Ga0466716_221801 | 3300042605 | Bacteria | 7997 |
| 51 | Ga0466719_292550 | 3300042606 | Bacteria | 5204 |
| 52 | Ga0466719_372328 | 3300042606 | Bacteria | 13807 |
| 53 | Ga0466719_409686 | 3300042606 | Bacteria | 4837 |
| 54 | Ga0466722_081713 | 3300042609 | Bacteria | 4561 |
| 55 | Ga0466735_034160 | 3300042624 | Bacteria | 5852 |
| 56 | Ga0466708_243982 | 3300042652 | Bacteria | 25514 |
| 57 | Ga0466727_050314 | 3300042655 | Bacteria | 3207 |
| 58 | IMNBL1DRAFT_c0002456 | 3300000062 | Bacteria | 12886 |
| 59 | Ga0072941_1057776 | 3300005201 | Bacteria | 1211 |
| 60 | Ga0466711_506207 | 3300042615 | Bacteria | 64484 |
| 61 | Ga0466723_011896 | 3300042618 | Bacteria | 13950 |
| 62 | Ga0466697_281336 | 3300042611 | Bacteria | 2541 |
| 63 | Ga0123357_10072924 | 3300009784 | Bacteria | 4547 |
| 64 | Ga0123353_10214590 | 3300010167 | Bacteria | 3015 |
| 65 | Ga0466696_352747 | 3300042596 | Bacteria | 11636 |
| 66 | Ga0466706_022534 | 3300042599 | Bacteria | 19846 |
| 67 | Ga0466707_312670 | 3300042601 | Bacteria | 1106 |
| 68 | Ga0466713_094496 | 3300042602 | Bacteria | 333875 |
| 69 | Ga0466713_141379 | 3300042602 | Bacteria | 226907 |
| 70 | Ga0466714_114642 | 3300042603 | Bacteria | 10091 |
| 71 | Ga0466719_043916 | 3300042606 | Bacteria | 13096 |
| 72 | Ga0466735_087774 | 3300042624 | Bacteria | 1242 |
| 73 | Ga0466703_091416 | 3300042636 | Bacteria | 2061 |
| 74 | Ga0466709_402849 | 3300042648 | Bacteria | 45308 |
| 75 | 2227035927 | 2225789003 | Bacteria | 4413 |
| 76 | JGI24702J35022_10000677 | 3300002462 | Bacteria | 20748 |
| 77 | Ga0466715_348253 | 3300042616 | Bacteria | 12317 |
| 78 | Ga0466705_001506 | 3300042612 | Bacteria | 8425 |
| 79 | Ga0466733_195303 | 3300042659 | Bacteria | 13173 |
| 80 | Ga0123357_10412288 | 3300009784 | Unclassified | 1216 |
| 81 | Ga0123356_10028550 | 3300010049 | Bacteria | 5228 |
| 82 | Ga0123353_10381535 | 3300010167 | Bacteria | 2108 |
| 83 | Ga0123354_10000176 | 3300010882 | Bacteria | 53249 |
| 84 | Ga0123354_10123479 | 3300010882 | Bacteria | 3324 |
| 85 | Ga0456237_0000065 | 3300041968 | Bacteria | 14834 |
| 86 | Ga0466690_001483 | 3300042590 | Bacteria | 12261 |
| 87 | Ga0466696_506148 | 3300042596 | Bacteria | 3362 |
| 88 | Ga0466706_075928 | 3300042599 | Bacteria | 44954 |
| 89 | Ga0466713_045333 | 3300042602 | Bacteria | 40925 |
| 90 | Ga0466713_129978 | 3300042602 | Bacteria | 70140 |
| 91 | Ga0466719_060679 | 3300042606 | Bacteria | 3727 |
| 92 | Ga0466722_019950 | 3300042609 | Bacteria | 5862 |
| 93 | Ga0466703_069218 | 3300042636 | Bacteria | 5838 |
| 94 | Ga0466704_504980 | 3300042643 | Bacteria | 9197 |
| 95 | Ga0466727_164388 | 3300042655 | Bacteria | 3664 |
| 96 | Ga0466727_272373 | 3300042655 | Bacteria | 4367 |
| 97 | Ga0466727_333743 | 3300042655 | Bacteria | 1416 |
| 98 | Ga0466705_516140 | 3300042612 | Bacteria | 1130 |
| 99 | Ga0466715_120204 | 3300042616 | Bacteria | 9711 |
| 100 | Ga0466697_270805 | 3300042611 | Bacteria | 1182 |
| 101 | Ga0466706_107146 | 3300042599 | Bacteria | 2353 |
| 102 | Ga0466700_039541 | 3300042600 | Bacteria | 6696 |
| 103 | Ga0466713_074241 | 3300042602 | Bacteria | 3771 |
| 104 | Ga0466714_053675 | 3300042603 | Bacteria | 1128 |
| 105 | Ga0466716_157890 | 3300042605 | Bacteria | 1184 |
| 106 | Ga0466722_074341 | 3300042609 | Bacteria | 7976 |
| 107 | Ga0466735_128261 | 3300042624 | Bacteria | 1773 |
| 108 | Ga0466730_064833 | 3300042625 | Bacteria | 3501 |
| 109 | Ga0466704_316152 | 3300042643 | Bacteria | 27672 |
| 110 | IMNBL1DRAFT_c0027420 | 3300000062 | Bacteria | 2142 |
| 111 | JGI24705J35276_12237012 | 3300002504 | Bacteria | 9561 |
| 112 | Ga0466712_099826 | 3300042614 | Bacteria | 3575 |
| 113 | Ga0466712_269988 | 3300042614 | Bacteria | 4724 |
| 114 | Ga0466705_387293 | 3300042612 | Bacteria | 2040 |
| 115 | Ga0466733_017106 | 3300042659 | Bacteria | 3468 |
| 116 | Ga0466733_062296 | 3300042659 | Bacteria | 3658 |
| 117 | Ga0123357_10102081 | 3300009784 | Unclassified | 3694 |
| 118 | Ga0466690_340718 | 3300042590 | Bacteria | 6390 |
| 119 | Ga0466693_394742 | 3300042592 | Bacteria | 1373 |
| 120 | Ga0466696_345175 | 3300042596 | Bacteria | 10393 |
| 121 | Ga0466701_015572 | 3300042598 | Unclassified | 1338 |
| 122 | Ga0466713_026689 | 3300042602 | Bacteria | 1969 |
| 123 | Ga0466713_087414 | 3300042602 | Bacteria | 21071 |
| 124 | Ga0466713_088905 | 3300042602 | Bacteria | 24788 |
| 125 | Ga0466714_064918 | 3300042603 | Bacteria | 1363 |
| 126 | Ga0466722_253038 | 3300042609 | Bacteria | 7100 |
| 127 | Ga0466735_044613 | 3300042624 | Bacteria | 1135 |
| 128 | Ga0466735_064027 | 3300042624 | Bacteria | 1733 |
| 129 | Ga0466735_112802 | 3300042624 | Bacteria | 1031 |
| 130 | Ga0466735_225820 | 3300042624 | Bacteria | 3066 |
| 131 | Ga0466703_053739 | 3300042636 | Bacteria | 8803 |
| 132 | Ga0466710_336335 | 3300042613 | Bacteria | 10060 |
| 133 | Ga0466712_052364 | 3300042614 | Bacteria | 2013 |
| 134 | Ga0466711_504720 | 3300042615 | Bacteria | 4514 |
| 135 | Ga0466723_358856 | 3300042618 | Bacteria | 10404 |
| 136 | Ga0466705_266468 | 3300042612 | Bacteria | 9836 |
| 137 | Ga0466733_045925 | 3300042659 | Bacteria | 9318 |
| 138 | Ga0123357_10203099 | 3300009784 | Bacteria | 2249 |
| 139 | Ga0123354_10002374 | 3300010882 | Bacteria | 24762 |
| 140 | Ga0466657_043935 | 3300042582 | Bacteria | 1222 |
| 141 | Ga0466690_404209 | 3300042590 | Bacteria | 3172 |
| 142 | Ga0466692_181143 | 3300042591 | Bacteria | 18569 |
| 143 | Ga0466691_195452 | 3300042593 | Bacteria | 11459 |
| 144 | Ga0466694_218066 | 3300042594 | Bacteria | 2544 |
| 145 | Ga0466706_122454 | 3300042599 | Bacteria | 1515 |
| 146 | Ga0466707_163876 | 3300042601 | Bacteria | 13368 |
| 147 | Ga0466714_000482 | 3300042603 | Bacteria | 4209 |
| 148 | Ga0466714_025360 | 3300042603 | Bacteria | 1118 |
| 149 | Ga0466722_179745 | 3300042609 | Bacteria | 2488 |
| 150 | Ga0466735_072645 | 3300042624 | Bacteria | 6232 |
| 151 | Ga0466735_150602 | 3300042624 | Bacteria | 1001 |
| 152 | Ga0466735_157637 | 3300042624 | Bacteria | 1969 |
| 153 | Ga0466703_018641 | 3300042636 | Bacteria | 2569 |
| 154 | Ga0466704_189513 | 3300042643 | Bacteria | 20859 |
| 155 | Ga0123357_10000330 | 3300009784 | Bacteria | 44905 |
| 156 | Ga0466710_355695 | 3300042613 | Unclassified | 12260 |
| 157 | Ga0466711_411906 | 3300042615 | Bacteria | 26972 |
| 158 | Ga0466715_157977 | 3300042616 | Bacteria | 113033 |
| 159 | Ga0466718_025279 | 3300042617 | Bacteria | 6093 |
| 160 | Ga0466728_093166 | 3300042620 | Bacteria | 80427 |
| 161 | Ga0466729_072099 | 3300042621 | Unclassified | 1549 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00696 | AA_kinase | Amino acid kinase family | 17 | 226 | 0.93 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.