Protein Family IF04185
Metagenome
Isolate
200
Members
57
Samples
192
Scaffolds
353.23
Avg Length
Representative Sequence
- ID
- 3300024493|Ga0264413_131710|Ga0264413_1317102
- Length
- 344 aa
- Sequence
- MVLSKKQKNIFTLILVLVLAAFVVIADKFFSPFVLRIFNLCGIYIILALSLNLTNGFTGLFSLGHAGFMAVGAYTSALLTMSPASRRINFFLAPIAAPLANLNLPFIPALIVAGLLTGLAGFIVGAPALRIRNSDYLAITTLGFSEIIRMVITNLQSVTNGALGLRRLPMYSTTYMIWGVAFISVVFIIVLLNSAFGRSCKAVRDDEIAARAIGINAVRIKITSFTIASFMAGIGGAMLGHMLSTIDPRMFTFTLTFNVLLIVVLGGSGSIISMEALRFLDGPLNLLFIRTQGLPGLRMVVFSILLLFVIIFRQQGLMGDRELSWEMIANFRLKLPKPEKKGTD
Sample Types
Isolate
4.0%
Metagenome
96.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
44.6%
Kalotermitidae
26.8%
Unclassified
16.1%
Rhinotermitidae
5.4%
Termopsidae
5.4%
Hodotermitidae
1.8%
Taxonomy
Archaea
0
Bacteria
192
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 2 | 2820010479 | Unclassified Spirochaetes Th196P4bin55 | Isolate | Unclassified |
| 3 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 7 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 8 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 9 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 10 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 11 | 2781125651 | Treponema sp. Co191P3bin8 | Isolate | Unclassified |
| 12 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 13 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 14 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 15 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 16 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 17 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 18 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 19 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 20 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 21 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 22 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 23 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 24 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 25 | 2503904012 | Sphaerochaeta coccoides SPN1, DSM 17374 | Isolate | Kalotermitidae |
| 26 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 27 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 28 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 29 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 30 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 31 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 32 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 33 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 34 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 35 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 36 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 37 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 38 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 39 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 40 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 41 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 42 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 43 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 44 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 45 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 46 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 47 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 48 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 49 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 50 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 51 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 52 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 53 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 54 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 55 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 56 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 57 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_102116 | 3300042656 | Bacteria | 3488 |
| 2 | Ga0466711_210375 | 3300042615 | Bacteria | 51464 |
| 3 | Ga0466715_025004 | 3300042616 | Bacteria | 13217 |
| 4 | Ga0466715_058114 | 3300042616 | Bacteria | 12665 |
| 5 | Ga0466715_060943 | 3300042616 | Bacteria | 9404 |
| 6 | Ga0466715_567417 | 3300042616 | Bacteria | 3687 |
| 7 | Ga0466723_315815 | 3300042618 | Bacteria | 18792 |
| 8 | Ga0466726_036876 | 3300042619 | Bacteria | 3752 |
| 9 | Ga0466726_135832 | 3300042619 | Bacteria | 5080 |
| 10 | Ga0466726_242205 | 3300042619 | Bacteria | 2098 |
| 11 | JGI24695J34938_10007973 | 3300002450 | Bacteria | 6112 |
| 12 | Ga0264413_131710 | 3300024493 | Bacteria | 2779 |
| 13 | Ga0415639_133589 | 3300038395 | Bacteria | 1988 |
| 14 | Ga0466691_070103 | 3300042593 | Bacteria | 31827 |
| 15 | Ga0466691_091661 | 3300042593 | Bacteria | 8865 |
| 16 | Ga0466699_269927 | 3300042597 | Unclassified | 1402 |
| 17 | Ga0123356_10212779 | 3300010049 | Bacteria | 1983 |
| 18 | Ga0123353_10140252 | 3300010167 | Bacteria | 3873 |
| 19 | Ga0466707_244794 | 3300042601 | Bacteria | 1473 |
| 20 | Ga0466716_011799 | 3300042605 | Bacteria | 6183 |
| 21 | Ga0466720_124970 | 3300042607 | Bacteria | 2281 |
| 22 | Ga0466735_135114 | 3300042624 | Bacteria | 12343 |
| 23 | Ga0466715_074298 | 3300042616 | Bacteria | 6698 |
| 24 | Ga0466726_029702 | 3300042619 | Bacteria | 17632 |
| 25 | Ga0466726_415802 | 3300042619 | Bacteria | 5822 |
| 26 | Ga0466726_433645 | 3300042619 | Bacteria | 7660 |
| 27 | AustNasuHG_c1003625 | 3300000089 | Bacteria | 5570 |
| 28 | Ga0466690_010693 | 3300042590 | Bacteria | 8227 |
| 29 | Ga0466690_014360 | 3300042590 | Bacteria | 3047 |
| 30 | Ga0466690_190397 | 3300042590 | Bacteria | 8163 |
| 31 | Ga0466693_167887 | 3300042592 | Bacteria | 10383 |
| 32 | Ga0466695_174847 | 3300042595 | Bacteria | 1143 |
| 33 | Ga0466696_358199 | 3300042596 | Bacteria | 4409 |
| 34 | Ga0466699_272692 | 3300042597 | Bacteria | 13032 |
| 35 | Ga0123353_10748894 | 3300010167 | Unclassified | 1360 |
| 36 | Ga0123354_10025831 | 3300010882 | Bacteria | 9261 |
| 37 | Ga0466706_111148 | 3300042599 | Bacteria | 3029 |
| 38 | Ga0466700_337784 | 3300042600 | Bacteria | 1238 |
| 39 | Ga0466707_165699 | 3300042601 | Bacteria | 2926 |
| 40 | Ga0466719_178271 | 3300042606 | Bacteria | 3875 |
| 41 | Ga0466722_007465 | 3300042609 | Bacteria | 26514 |
| 42 | Ga0466722_094849 | 3300042609 | Bacteria | 3236 |
| 43 | Ga0466705_112086 | 3300042612 | Bacteria | 12461 |
| 44 | Ga0466703_117340 | 3300042636 | Bacteria | 1644 |
| 45 | Ga0466704_057747 | 3300042643 | Bacteria | 4663 |
| 46 | Ga0466704_324488 | 3300042643 | Bacteria | 10013 |
| 47 | Ga0466704_522007 | 3300042643 | Bacteria | 15059 |
| 48 | Ga0466705_455008 | 3300042612 | Bacteria | 8073 |
| 49 | Ga0466723_119865 | 3300042618 | Bacteria | 4969 |
| 50 | Ga0466723_210681 | 3300042618 | Bacteria | 8686 |
| 51 | Ga0466723_286733 | 3300042618 | Bacteria | 5385 |
| 52 | Ga0466726_158653 | 3300042619 | Bacteria | 3437 |
| 53 | Ga0466726_489899 | 3300042619 | Bacteria | 3341 |
| 54 | Ga0466728_023166 | 3300042620 | Bacteria | 15136 |
| 55 | Ga0466690_105288 | 3300042590 | Bacteria | 3653 |
| 56 | Ga0466695_234944 | 3300042595 | Bacteria | 11163 |
| 57 | Ga0466696_388583 | 3300042596 | Bacteria | 1446 |
| 58 | Ga0123357_10103911 | 3300009784 | Bacteria | 3652 |
| 59 | Ga0123353_10651913 | 3300010167 | Bacteria | 1490 |
| 60 | Ga0466707_353009 | 3300042601 | Bacteria | 1962 |
| 61 | Ga0466716_009123 | 3300042605 | Bacteria | 5844 |
| 62 | Ga0466720_108612 | 3300042607 | Bacteria | 122313 |
| 63 | Ga0466722_017904 | 3300042609 | Bacteria | 9151 |
| 64 | Ga0466735_105350 | 3300042624 | Bacteria | 2118 |
| 65 | Ga0466703_003421 | 3300042636 | Bacteria | 2968 |
| 66 | Ga0466703_028252 | 3300042636 | Bacteria | 7507 |
| 67 | Ga0466703_149805 | 3300042636 | Bacteria | 2752 |
| 68 | Ga0466704_212925 | 3300042643 | Bacteria | 2489 |
| 69 | Ga0466704_325436 | 3300042643 | Bacteria | 20045 |
| 70 | Ga0466704_533080 | 3300042643 | Bacteria | 39781 |
| 71 | Ga0466709_162417 | 3300042648 | Bacteria | 1272 |
| 72 | Ga0466709_195113 | 3300042648 | Bacteria | 3508 |
| 73 | Ga0466708_140681 | 3300042652 | Bacteria | 8141 |
| 74 | Ga0466708_379270 | 3300042652 | Bacteria | 6383 |
| 75 | Ga0466727_254597 | 3300042655 | Bacteria | 2670 |
| 76 | Ga0466733_005154 | 3300042659 | Bacteria | 7162 |
| 77 | Ga0466723_150825 | 3300042618 | Bacteria | 28092 |
| 78 | Ga0466692_031566 | 3300042591 | Bacteria | 1437 |
| 79 | Ga0466692_035880 | 3300042591 | Bacteria | 11382 |
| 80 | Ga0466692_049903 | 3300042591 | Bacteria | 1315 |
| 81 | Ga0466691_126990 | 3300042593 | Bacteria | 2193 |
| 82 | Ga0466691_197486 | 3300042593 | Unclassified | 3538 |
| 83 | Ga0466696_279844 | 3300042596 | Bacteria | 12900 |
| 84 | Ga0466699_069067 | 3300042597 | Bacteria | 1161 |
| 85 | Ga0123355_10000558 | 3300009826 | Bacteria | 49958 |
| 86 | Ga0123356_10234605 | 3300010049 | Bacteria | 1901 |
| 87 | Ga0123356_10325957 | 3300010049 | Bacteria | 1651 |
| 88 | Ga0123356_10347695 | 3300010049 | Bacteria | 1605 |
| 89 | Ga0123353_10228499 | 3300010167 | Bacteria | 2903 |
| 90 | Ga0466701_101046 | 3300042598 | Bacteria | 1181 |
| 91 | Ga0466707_015035 | 3300042601 | Bacteria | 1968 |
| 92 | Ga0466722_138432 | 3300042609 | Bacteria | 1314 |
| 93 | Ga0466705_047500 | 3300042612 | Unclassified | 4087 |
| 94 | Ga0466708_008245 | 3300042652 | Bacteria | 3353 |
| 95 | Ga0466727_034957 | 3300042655 | Bacteria | 1830 |
| 96 | Ga0466712_252004 | 3300042614 | Bacteria | 3313 |
| 97 | Ga0466718_004820 | 3300042617 | Bacteria | 3634 |
| 98 | Ga0466723_147912 | 3300042618 | Bacteria | 18502 |
| 99 | Ga0466726_038525 | 3300042619 | Bacteria | 7563 |
| 100 | Ga0466690_097902 | 3300042590 | Bacteria | 1137 |
| 101 | Ga0466691_141463 | 3300042593 | Bacteria | 9084 |
| 102 | Ga0466691_195447 | 3300042593 | Bacteria | 18449 |
| 103 | Ga0466699_027016 | 3300042597 | Bacteria | 2339 |
| 104 | Ga0123353_10175986 | 3300010167 | Bacteria | 3392 |
| 105 | Ga0466707_230858 | 3300042601 | Bacteria | 5710 |
| 106 | Ga0466719_068300 | 3300042606 | Bacteria | 3572 |
| 107 | Ga0466722_018969 | 3300042609 | Bacteria | 4564 |
| 108 | Ga0466722_168284 | 3300042609 | Bacteria | 10950 |
| 109 | Ga0466705_094996 | 3300042612 | Bacteria | 12271 |
| 110 | Ga0466729_203101 | 3300042621 | Bacteria | 4870 |
| 111 | Ga0466735_060663 | 3300042624 | Bacteria | 4314 |
| 112 | Ga0466704_115725 | 3300042643 | Bacteria | 5897 |
| 113 | Ga0466709_320575 | 3300042648 | Bacteria | 2941 |
| 114 | Ga0466708_040845 | 3300042652 | Bacteria | 2332 |
| 115 | Ga0466708_069259 | 3300042652 | Bacteria | 49691 |
| 116 | Ga0466715_076216 | 3300042616 | Bacteria | 5367 |
| 117 | Ga0466715_397221 | 3300042616 | Bacteria | 3225 |
| 118 | JGI24698J34947_10000402 | 3300002449 | Bacteria | 19694 |
| 119 | JGI24695J34938_10015198 | 3300002450 | Bacteria | 3956 |
| 120 | JGI24702J35022_10004640 | 3300002462 | Bacteria | 8133 |
| 121 | Ga0466692_204077 | 3300042591 | Bacteria | 6982 |
| 122 | Ga0466694_298480 | 3300042594 | Bacteria | 2218 |
| 123 | Ga0466696_155739 | 3300042596 | Bacteria | 5265 |
| 124 | Ga0466696_200595 | 3300042596 | Bacteria | 25839 |
| 125 | Ga0466699_196222 | 3300042597 | Bacteria | 1427 |
| 126 | Ga0466699_354350 | 3300042597 | Bacteria | 3188 |
| 127 | Ga0123356_10199705 | 3300010049 | Bacteria | 2038 |
| 128 | Ga0123356_10521359 | 3300010049 | Bacteria | 1347 |
| 129 | Ga0123353_10034416 | 3300010167 | Bacteria | 7905 |
| 130 | Ga0123353_10093508 | 3300010167 | Bacteria | 4845 |
| 131 | Ga0466716_017595 | 3300042605 | Bacteria | 5705 |
| 132 | Ga0466716_175919 | 3300042605 | Bacteria | 3147 |
| 133 | Ga0466719_233492 | 3300042606 | Bacteria | 2315 |
| 134 | Ga0466722_069109 | 3300042609 | Bacteria | 31526 |
| 135 | Ga0466722_073106 | 3300042609 | Bacteria | 11615 |
| 136 | Ga0466705_111836 | 3300042612 | Bacteria | 12299 |
| 137 | Ga0466735_060861 | 3300042624 | Bacteria | 1539 |
| 138 | Ga0466704_466856 | 3300042643 | Bacteria | 8356 |
| 139 | Ga0466708_083996 | 3300042652 | Bacteria | 14281 |
| 140 | Ga0466712_188805 | 3300042614 | Bacteria | 13038 |
| 141 | Ga0466712_299259 | 3300042614 | Bacteria | 5649 |
| 142 | Ga0466711_353856 | 3300042615 | Bacteria | 8505 |
| 143 | Ga0466723_373824 | 3300042618 | Bacteria | 4530 |
| 144 | JGI24698J34947_10049387 | 3300002449 | Bacteria | 2126 |
| 145 | Ga0466690_094456 | 3300042590 | Bacteria | 15806 |
| 146 | Ga0466692_067144 | 3300042591 | Bacteria | 3813 |
| 147 | Ga0466692_178806 | 3300042591 | Bacteria | 32596 |
| 148 | Ga0123354_10253329 | 3300010882 | Bacteria | 1777 |
| 149 | Ga0466713_127695 | 3300042602 | Bacteria | 1385 |
| 150 | Ga0466714_115211 | 3300042603 | Bacteria | 3334 |
| 151 | Ga0466716_038086 | 3300042605 | Bacteria | 8613 |
| 152 | Ga0466716_116665 | 3300042605 | Bacteria | 13109 |
| 153 | Ga0466721_391278 | 3300042608 | Bacteria | 10971 |
| 154 | Ga0466722_164416 | 3300042609 | Bacteria | 3685 |
| 155 | Ga0466705_105838 | 3300042612 | Bacteria | 8008 |
| 156 | Ga0466705_354195 | 3300042612 | Bacteria | 15438 |
| 157 | Ga0466735_098193 | 3300042624 | Bacteria | 1568 |
| 158 | Ga0466704_080954 | 3300042643 | Bacteria | 11536 |
| 159 | Ga0466704_304480 | 3300042643 | Bacteria | 25615 |
| 160 | Ga0466708_327203 | 3300042652 | Bacteria | 31501 |
| 161 | Ga0466708_401033 | 3300042652 | Bacteria | 3677 |
| 162 | Ga0466727_185844 | 3300042655 | Bacteria | 1788 |
| 163 | Ga0466732_060557 | 3300042656 | Bacteria | 1918 |
| 164 | Ga0466711_096348 | 3300042615 | Bacteria | 13113 |
| 165 | Ga0466711_396852 | 3300042615 | Bacteria | 14422 |
| 166 | Ga0466715_242579 | 3300042616 | Bacteria | 5390 |
| 167 | Ga0466715_519280 | 3300042616 | Bacteria | 12079 |
| 168 | Ga0466723_055406 | 3300042618 | Bacteria | 5148 |
| 169 | Ga0466723_272747 | 3300042618 | Bacteria | 5531 |
| 170 | Ga0466726_256373 | 3300042619 | Bacteria | 1670 |
| 171 | Ga0466728_057907 | 3300042620 | Bacteria | 2473 |
| 172 | Ga0074263_100539 | 3300005485 | Unclassified | 2705 |
| 173 | Ga0466690_267699 | 3300042590 | Unclassified | 2820 |
| 174 | Ga0466692_010331 | 3300042591 | Bacteria | 5788 |
| 175 | Ga0466692_106846 | 3300042591 | Bacteria | 1928 |
| 176 | Ga0466692_159636 | 3300042591 | Bacteria | 2510 |
| 177 | Ga0466694_398457 | 3300042594 | Bacteria | 2681 |
| 178 | Ga0466696_117133 | 3300042596 | Bacteria | 5653 |
| 179 | Ga0466696_240099 | 3300042596 | Bacteria | 2467 |
| 180 | Ga0123357_10074582 | 3300009784 | Bacteria | 4487 |
| 181 | Ga0123356_10458720 | 3300010049 | Bacteria | 1424 |
| 182 | Ga0466719_271470 | 3300042606 | Bacteria | 8292 |
| 183 | Ga0466719_282348 | 3300042606 | Unclassified | 19679 |
| 184 | Ga0466722_164741 | 3300042609 | Bacteria | 4327 |
| 185 | Ga0466698_031279 | 3300042610 | Bacteria | 3169 |
| 186 | Ga0466698_268809 | 3300042610 | Bacteria | 2639 |
| 187 | Ga0466705_125619 | 3300042612 | Unclassified | 1839 |
| 188 | Ga0466703_088782 | 3300042636 | Bacteria | 17464 |
| 189 | Ga0466704_283505 | 3300042643 | Bacteria | 3411 |
| 190 | Ga0466709_091610 | 3300042648 | Bacteria | 4989 |
| 191 | Ga0466709_394333 | 3300042648 | Bacteria | 6049 |
| 192 | Ga0466727_206330 | 3300042655 | Bacteria | 1598 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02653 | BPD_transp_2 | Branched-chain amino acid transport system / permease component | 34 | 309 | 0.88 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.