Protein Family IF03914
Metagenome
Isolate
171
Members
142
Samples
73
Scaffolds
531.43
Avg Length
Representative Sequence
- ID
- 3300012846|Ga0160433_100217|Ga0160433_10021719
- Length
- 583 aa
- Sequence
- MRGTAQWLMFDAGGANAYAAMTRSILELFAQRPGWPRIAFALAWETGVQVKPSFGMNDQGITTAADVKWNLLTAPLVEEAVRNGEGVLAKDGPLVVETGKHTGRSAKDKFIVRDATTEETISWGDVNVPMTPERFAALKADFFAALGEKKQLYVADLFGGSQAEHRVNVRVINEFAWHNLFIRTLLVRPERDTLAGFTPEYTIIDLPSFRADPARHGSRSETIIAVNFTEKLILIGGTAYAGEMKKSVFSILNYLLPAKGIMPMHCSANIGPDGDTAVFFGLSGTGKTTLSADASRTLIGDDEHGWSDTAVFNFEGGCYAKMIRLSAEAEPEIFATTKRFGTVLENVVIDPETREIDLDDATLAENSRGSYPIDFIPNASEDNLGPVPKNIIFLTADAYGVLPPIARLTPDQAMYHFLSGYTARVAGTEIGVTEPQATFSTCFGAPFMPRRPSVYGNLLKERIAKGGVKCWLVNTGWTGGKATDPGISRMPIKVTRALLNAALDGSLNNAEFRVDPNFGFEVPVAVGDIDPNMLDPRAAWSDKARYDETAADLLGKFVANFTQFEGDVDASVRDVLKAPVAA*
Sample Types
Isolate
57.3%
Metagenome
42.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
16.4%
Apidae
13.4%
Drosophilidae
11.9%
Termitidae
11.9%
Elmidae
7.5%
Kalotermitidae
5.2%
Formicidae
5.2%
Pyralidae
4.5%
Culicidae
4.5%
Armadillidiidae
3.0%
Nephropidae
2.2%
Scarabaeidae
2.2%
Bombycidae
2.2%
Portunidae
0.7%
Calliphoridae
0.7%
Tenebrionidae
0.7%
Hodotermitidae
0.7%
Ocypodidae
0.7%
Daphniidae
0.7%
Euphausiidae
0.7%
Passalidae
0.7%
Curculionidae
0.7%
Noctuidae
0.7%
Eresidae
0.7%
Rhinotermitidae
0.7%
Muscidae
0.7%
Taxonomy
Archaea
0
Bacteria
161
Eukaryota
0
Viruses
0
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2751185853 | Bartonella apis BBC0178 | Isolate | Apidae |
| 2 | 2858102877 | Acetobacter orientalis DmW_048 | Isolate | Drosophilidae |
| 3 | 2858129007 | Acetobacter orientalis DmW_045 | Isolate | Drosophilidae |
| 4 | 2864878056 | Flavobacterium notoginsengisoli S00128 | Isolate | Elmidae |
| 5 | 2864886855 | Flavobacterium nitrogenifigens S00142 | Isolate | Elmidae |
| 6 | 2864981449 | Sporosarcina sp. S00266 | Isolate | Elmidae |
| 7 | 2896330536 | Sphingobacterium sp. xlx-96 | Isolate | |
| 8 | 643886087 | Bacillus thuringiensis sv. kurstaki T03a001 | Isolate | Pyralidae |
| 9 | 643886090 | Bacillus thuringiensis sv. pakistani t13001 | Isolate | Unclassified |
| 10 | 8061100935 | Bacillus thuringiensis sv. japonensis 62 | Isolate | |
| 11 | 8068944069 | Bartonella choladocola W8125 | Isolate | Apidae |
| 12 | 8068955631 | Bartonella apihabitans M0280 | Isolate | Apidae |
| 13 | 8073628750 | Bartonella sp. W8167 | Isolate | Apidae |
| 14 | 2969145278 | Bacillus cereus 29 | Isolate | Portunidae |
| 15 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 16 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 17 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 18 | 2209111004 | Macrotermes natalensis queen gut microbiome | Metagenome | Termitidae |
| 19 | 2590828839 | Clostridium sp. 1 | Isolate | Termitidae |
| 20 | 2806310572 | Pukyongiella litopenaei SH-1 | Isolate | Unclassified |
| 21 | 2827179085 | Paenibacillus alvei DSM 29 | Isolate | Apidae |
| 22 | 2828301124 | Sphingomonas leidyi DSM 4733 | Isolate | Unclassified |
| 23 | 2835143510 | Yoonia maritima YPC211 | Isolate | Nephropidae |
| 24 | 2852123468 | Lysinibacillus sphaericus KCCM 35418 | Isolate | Unclassified |
| 25 | 2852431164 | Brevibacillus laterosporus BON707 | Isolate | Calliphoridae |
| 26 | 2858089842 | Acetobacter tropicalis DmW_042 | Isolate | Drosophilidae |
| 27 | 2858110640 | Acetobacter indonesiensis DmL_051 | Isolate | Drosophilidae |
| 28 | 2882250448 | Bizionia sp. APA-3 | Isolate | |
| 29 | 2912849059 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 30 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 31 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 32 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 33 | 8068946563 | Bartonella apihabitans M0187 | Isolate | Apidae |
| 34 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 35 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 36 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 37 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 38 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 39 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 40 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 41 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 42 | 2767802234 | Cytobacillus kochii BDGP4 | Isolate | Drosophilidae |
| 43 | 2816332503 | Tritonibacter mobilis S1611 | Isolate | Unclassified |
| 44 | 2822450720 | Bacillus toyonensis AFS052650 | Isolate | Scarabaeidae |
| 45 | 2864782175 | Bacillus toyonensis S00025 | Isolate | Elmidae |
| 46 | 2868683769 | Acetobacter sp. DmW_043 | Isolate | Drosophilidae |
| 47 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 48 | 651324002 | Acetonema longum APO-1, DSM 6540 | Isolate | Kalotermitidae |
| 49 | 8043041867 | Bacillus pumilus Ha06YP001 | Isolate | Nephropidae |
| 50 | 8073624232 | Bartonella sp. W8151 | Isolate | Apidae |
| 51 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 52 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 53 | 2978778678 | Bacillus cereus 25 | Isolate | Ocypodidae |
| 54 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 55 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 56 | 2711768164 | Tritonibacter mobilis S1942 | Isolate | Unclassified |
| 57 | 2751185856 | Bartonella apis BBC0244 | Isolate | Apidae |
| 58 | 2811995047 | Flavobacterium succinicans DD5b | Isolate | Daphniidae |
| 59 | 2816332478 | Acetobacter tropicalis BDGP1 | Isolate | Drosophilidae |
| 60 | 2816332545 | Tritonibacter mobilis S1923 | Isolate | Unclassified |
| 61 | 2820115951 | Unclassified Proteobacteria Emb289P4bin33 | Isolate | Unclassified |
| 62 | 2820441105 | Unclassified Firmicutes Lab288P3bin202 | Isolate | Unclassified |
| 63 | 2854540230 | Acetobacter sp. DsW_063 | Isolate | Drosophilidae |
| 64 | 2855361764 | Lysinibacillus fusiformis Juneja | Isolate | Drosophilidae |
| 65 | 2864909992 | Bacillus velezensis S00166 | Isolate | Elmidae |
| 66 | 2868677537 | Acetobacter orientalis DsW_061 | Isolate | Drosophilidae |
| 67 | 2898741527 | Sphingobacterium sp. xlx-73 | Isolate | |
| 68 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 69 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 70 | 8061039349 | Bacillus thuringiensis sv. galleriae BGSC 4G4 | Isolate | Bombycidae |
| 71 | 8073617375 | Bartonella apis W8098 | Isolate | Apidae |
| 72 | 8082291289 | Bartonella apihabitans K-FP28 | Isolate | Apidae |
| 73 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 74 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 75 | 2537562000 | Bacillus cereus HD73 | Isolate | Pyralidae |
| 76 | 2574180310 | Bacillus licheniformis CG-B52 | Isolate | Unclassified |
| 77 | 2695420964 | Hyphomicrobiales bacterium JR021 | Isolate | Unclassified |
| 78 | 2751185858 | Bartonella apis BBC0122 | Isolate | Apidae |
| 79 | 2820127165 | Unclassified Proteobacteria Emb289P3bin90 | Isolate | Unclassified |
| 80 | 2864955722 | Sphingomonas kyeonggiensis S00224 | Isolate | Elmidae |
| 81 | 2886876212 | Tokpelaia sp. RhiAcro1 | Isolate | Formicidae |
| 82 | 2896350215 | Sphingobacterium sp. xlx-183 | Isolate | |
| 83 | 8002519755 | Planococcus sp. MSAK28401 | Isolate | Euphausiidae |
| 84 | 8061045771 | Bacillus thuringiensis sv. kurstaki BGSC 4D1 | Isolate | Bombycidae |
| 85 | 8068941587 | Bartonella choladocola B10834H15 | Isolate | Apidae |
| 86 | 8073619611 | Bartonella apis B10834G6 | Isolate | Apidae |
| 87 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 88 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 89 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 90 | 2524614537 | Lysinibacillus sphaericus OT4b.31 | Isolate | Unclassified |
| 91 | 2751185832 | Lysinibacillus sp. AR18-8 | Isolate | Unclassified |
| 92 | 2822232166 | Bacillus toyonensis AFS084242 | Isolate | Scarabaeidae |
| 93 | 2839785767 | Thalassobius sp. I31.1 | Isolate | Nephropidae |
| 94 | 2854518031 | Acetobacter indonesiensis DmW_046 | Isolate | Drosophilidae |
| 95 | 2864891731 | Chryseobacterium defluvii S00151 | Isolate | Elmidae |
| 96 | 2890957088 | Psychrobacillus lasiicapitis NEAU-3TGS17 | Isolate | Formicidae |
| 97 | 8073626464 | Bartonella apis W8152 | Isolate | Apidae |
| 98 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 99 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 100 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 101 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 102 | 2563367190 | Bacillus thuringiensis sv. aizawai Leapi01 | Isolate | Noctuidae |
| 103 | 2791355481 | Bacillus sp. ZY-1-1 | Isolate | Scarabaeidae |
| 104 | 2820142992 | Unclassified Proteobacteria Emb289P3bin113 | Isolate | Unclassified |
| 105 | 2820451402 | Unclassified Firmicutes Lab288P3bin174 | Isolate | Unclassified |
| 106 | 2843246524 | Lysinibacillus sphaericus DSM 28 | Isolate | Unclassified |
| 107 | 2864895409 | Bacillus aerius S00152 | Isolate | Elmidae |
| 108 | 2864976888 | Novosphingobium chloroacetimidivorans S00245 | Isolate | Elmidae |
| 109 | 2896321640 | Sphingobacterium sp. xlx-130 | Isolate | |
| 110 | 2916873227 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 111 | 8022725327 | Bacillus sp. SN10 | Isolate | Eresidae |
| 112 | 8022781829 | Bacillus sp. VKPM B-3276 | Isolate | Culicidae |
| 113 | 8068953321 | Bartonella apihabitans M0190 | Isolate | Apidae |
| 114 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 115 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 116 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 117 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 118 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 119 | 3300009460 | Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov | Metagenome | |
| 120 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 121 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 122 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 123 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 124 | 8116947750 | Gluconacetobacter sacchari DSM 12717 | Isolate | Unclassified |
| 125 | 2579779088 | Sphingobacterium paucimobilis HER1398 | Isolate | Bombycidae |
| 126 | 2593339125 | Clostridium sp. 5 | Isolate | Termitidae |
| 127 | 2636416028 | Pelosinus propionicus DSM 13327 | Isolate | Unclassified |
| 128 | 2718218026 | Phaeobacter porticola P97 | Isolate | Unclassified |
| 129 | 2834852038 | Acetobacter cibinongensis DsW_47 | Isolate | Drosophilidae |
| 130 | 2841330038 | Sulfitobacter sp. D7 | Isolate | |
| 131 | 2864801025 | Bacillus aerius S00042 | Isolate | Elmidae |
| 132 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 133 | 643886085 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 134 | 643886091 | Bacillus thuringiensis sv. thuringiensis T01001 | Isolate | Pyralidae |
| 135 | 8067483258 | Ochrobactrum soli MTP-C0764 | Isolate | Muscidae |
| 136 | 8068950955 | Bartonella apihabitans W8097 | Isolate | Apidae |
| 137 | 8073621894 | Bartonella apis W8099 | Isolate | Apidae |
| 138 | 2989309576 | Sporomusa termitida DSM 4440 | Isolate | Unclassified |
| 139 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 140 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 141 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 142 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466707_040784 | 3300042601 | Bacteria | 59863 |
| 2 | JGI24702J35022_10026865 | 3300002462 | Bacteria | 3098 |
| 3 | Ga0074278_154579 | 3300005721 | Bacteria | 6884 |
| 4 | Ga0104050_1001682 | 3300007153 | Bacteria | 13586 |
| 5 | Ga0466696_220610 | 3300042596 | Bacteria | 9161 |
| 6 | Ga0466724_44792 | 3300042649 | Bacteria | 6543 |
| 7 | Ga0123356_10031525 | 3300010049 | Bacteria | 4960 |
| 8 | Ga0466719_290641 | 3300042606 | Bacteria | 8152 |
| 9 | Ga0104045_1005066 | 3300007085 | Unclassified | 6149 |
| 10 | Ga0104050_1030692 | 3300007153 | Unclassified | 2287 |
| 11 | Ga0160455_101366 | 3300012837 | Bacteria | 7567 |
| 12 | Ga0160472_101396 | 3300012839 | Unclassified | 7210 |
| 13 | Ga0160447_100011 | 3300012849 | Bacteria | 463863 |
| 14 | Ga0466715_317474 | 3300042616 | Bacteria | 28415 |
| 15 | Ga0530661_000915 | 3300056564 | Bacteria | 17839 |
| 16 | Ga0123356_10106922 | 3300010049 | Bacteria | 2695 |
| 17 | Ga0123353_10001502 | 3300010167 | Bacteria | 28580 |
| 18 | Ga0063521_1000525 | 3300003973 | Bacteria | 17214 |
| 19 | Ga0104019_1005060 | 3300007150 | Bacteria | 5244 |
| 20 | Ga0160456_100001 | 3300012820 | Bacteria | 1115787 |
| 21 | Ga0466657_042903 | 3300042582 | Bacteria | 1750 |
| 22 | Ga0466657_109529 | 3300042582 | Bacteria | 25557 |
| 23 | Ga0123353_10108030 | 3300010167 | Unclassified | 4484 |
| 24 | CVPL010L_1000004 | 3300002932 | Bacteria | 122747 |
| 25 | Ga0072940_1056999 | 3300005200 | Bacteria | 2010 |
| 26 | Ga0102738_1000042 | 3300007141 | Bacteria | 59015 |
| 27 | Ga0103267_1000045 | 3300007190 | Bacteria | 74090 |
| 28 | Ga0160446_100009 | 3300012835 | Bacteria | 341409 |
| 29 | Ga0160460_100108 | 3300012845 | Bacteria | 114707 |
| 30 | Ga0466708_081554 | 3300042652 | Bacteria | 30455 |
| 31 | Ga0466733_131886 | 3300042659 | Bacteria | 6248 |
| 32 | Ga0123356_10009260 | 3300010049 | Bacteria | 9728 |
| 33 | Ga0123356_10016485 | 3300010049 | Bacteria | 7047 |
| 34 | Ga0466707_174018 | 3300042601 | Bacteria | 2603 |
| 35 | Ga0466717_078841 | 3300042604 | Bacteria | 4088 |
| 36 | Ga0466721_090289 | 3300042608 | Bacteria | 2738 |
| 37 | Ga0104048_1168451 | 3300007143 | Unclassified | 6325 |
| 38 | Ga0104050_1026123 | 3300007153 | Unclassified | 7466 |
| 39 | Ga0160460_100148 | 3300012845 | Bacteria | 80857 |
| 40 | Ga0466696_023405 | 3300042596 | Bacteria | 42390 |
| 41 | Ga0123356_10017757 | 3300010049 | Bacteria | 6760 |
| 42 | 2211830555 | 2209111004 | Bacteria | 21478 |
| 43 | CVPL010W_10006870 | 3300002931 | Bacteria | 11457 |
| 44 | CVPL005W_1000248 | 3300002934 | Bacteria | 23457 |
| 45 | Ga0160446_100071 | 3300012835 | Bacteria | 101245 |
| 46 | Ga0160457_1000010 | 3300012858 | Bacteria | 500717 |
| 47 | Ga0466657_150244 | 3300042582 | Bacteria | 14090 |
| 48 | Ga0466734_127287 | 3300042623 | Bacteria | 12928 |
| 49 | Ga0466715_127167 | 3300042616 | Bacteria | 83910 |
| 50 | Ga0123356_10011157 | 3300010049 | Unclassified | 8772 |
| 51 | Ga0466706_131958 | 3300042599 | Bacteria | 3176 |
| 52 | Ga0466706_134026 | 3300042599 | Bacteria | 5941 |
| 53 | Ga0104048_1002243 | 3300007143 | Bacteria | 9321 |
| 54 | Ga0123357_10000834 | 3300009784 | Bacteria | 31276 |
| 55 | Ga0123357_10000965 | 3300009784 | Bacteria | 29254 |
| 56 | Ga0466730_056090 | 3300042625 | Bacteria | 2576 |
| 57 | Ga0466730_079418 | 3300042625 | Bacteria | 679131 |
| 58 | Ga0466704_325088 | 3300042643 | Unclassified | 38417 |
| 59 | Ga0466724_47083 | 3300042649 | Bacteria | 378486 |
| 60 | Ga0466724_64213 | 3300042649 | Bacteria | 1880 |
| 61 | Ga0123353_10000890 | 3300010167 | Bacteria | 36477 |
| 62 | Ga0466717_187766 | 3300042604 | Unclassified | 3611 |
| 63 | Ga0466722_253258 | 3300042609 | Bacteria | 6136 |
| 64 | IMNBL1DRAFT_c0000113 | 3300000062 | Bacteria | 72819 |
| 65 | JGI24705J35276_12236157 | 3300002504 | Bacteria | 7576 |
| 66 | Ga0063521_1000290 | 3300003973 | Unclassified | 30884 |
| 67 | Ga0103267_1000192 | 3300007190 | Bacteria | 56966 |
| 68 | Ga0127649_104927 | 3300009460 | Bacteria | 36792 |
| 69 | Ga0160459_102021 | 3300012831 | Bacteria | 3600 |
| 70 | Ga0160433_100217 | 3300012846 | Bacteria | 43589 |
| 71 | Ga0466657_008626 | 3300042582 | Bacteria | 77234 |
| 72 | Ga0466711_139054 | 3300042615 | Bacteria | 24266 |
| 73 | Ga0466715_171580 | 3300042616 | Bacteria | 16482 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01293 | PEPCK_ATP | Phosphoenolpyruvate carboxykinase | 66 | 530 | 0.99 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.