Protein Family IF03846

Metagenome Isolate
192 Members
128 Samples
108 Scaffolds
331.38 Avg Length

🧬 Representative Sequence

ID
3300012839|Ga0160472_100010|Ga0160472_100010325
Length
319 aa
Sequence
MKYNRCGNSGLLLPAISLGLWHNFGSVDVFDNGRNIVRRAFDRGITHFDLANNYGPEPGSAEENFGEILKKDFPGYLRDELIISSKAGYLMWPGPYGNWGSRKYLISSLDQSLQRMGLDYVDIFYSHRPDPETPIEETMMALDTVVRQGKALYVGLSNYNAEQADKAIQILKSLGTPCLIHQPKYSMFERWVEGGLLDVLEKHGVGCIPFSPLAQGMLTDKYLKGIPEGSRAAKEHGFLKEKDITPERLQKIQKLNELAKTRNQSLAQMALSWLLKDKRITTVLIGASSVAQLDNNIDALNNIDYSESELKAIEDILK*

📊 Sample Types

Isolate 43.8%
Metagenome 56.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Muscidae 10.3%
Termitidae 10.3%
Unclassified 10.3%
Blattidae 9.4%
Kalotermitidae 8.5%
Drosophilidae 6.8%
Curculionidae 6.0%
Tenebrionidae 6.0%
Armadillidiidae 5.1%
Culicidae 3.4%
Rhinotermitidae 2.6%
Tephritidae 2.6%
Calliphoridae 2.6%
Plutellidae 1.7%
Cerambycidae 1.7%
Aphididae 1.7%
Sarcophagidae 1.7%
Formicidae 1.7%
Pteromalidae 0.9%
Daphniidae 0.9%
Hydrophilidae 0.9%
Anthomyiidae 0.9%
Pentatomidae 0.9%
Carabidae 0.9%
Crambidae 0.9%
Termopsidae 0.9%
Anthocoridae 0.9%

🌳 Taxonomy

Archaea 0
Bacteria 184
Eukaryota 0
Viruses 0
Unclassified 8

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2065487013 Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm Metagenome
2 2765235945 Kosakonia cowanii Esp_Z Isolate Culicidae
3 2923982719 Parabacteroides sp. 52 Isolate Blattidae
4 2940419646 Paenibacillus sp. PastF-4 Isolate Blattidae
5 2977691992 Cronobacter malonaticus MOD1-Md27g Isolate Muscidae
6 2977745872 Cronobacter sakazakii MOD1-Md1g Isolate Muscidae
7 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
8 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
9 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
10 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
11 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
12 8100176769 Kosakonia sp. S57 Isolate Curculionidae
13 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
14 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
15 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
16 2547132185 Enterobacter cancerogenus YZ1 Isolate Tenebrionidae
17 2619619082 Pantoea agglomerans SL1_M5 Isolate Unclassified
18 2822856742 Enterobacter cancerogenus CR-Eb1 Isolate Unclassified
19 2850131454 Providencia rettgeri NVIT03 Isolate Pteromalidae
20 2874880541 Enterobacter hormaechei E3442 Isolate Unclassified
21 2940386776 Paenibacillus sp. PastF-1 Isolate Blattidae
22 2964846109 Cronobacter sakazakii MOD1-Md5g Isolate Muscidae
23 2964859436 Cronobacter sakazakii MOD1-Md40g Isolate Muscidae
24 3000861951 Budvicia diplopodorum D9 Isolate
25 3004364956 Cronobacter sakazakii MOD1-Md5s Isolate Muscidae
26 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
27 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae
28 3300035364 Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - adult gut Metagenome Plutellidae
29 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
30 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
31 646311952 Sebaldella termitidis ATCC 33386 Isolate Unclassified
32 8018312681 Enterobacter sp. OLF Isolate Tephritidae
33 8021540981 Klebsiella sp. Kpp Isolate Tephritidae
34 8028002147 Enterobacter sp. 10-1 Isolate Cerambycidae
35 8099192374 Erwinia typographi IC4 Isolate Curculionidae
36 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
37 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
38 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
39 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
40 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
41 2529292851 Providencia burhodogranariea DSM 19968 Isolate Drosophilidae
42 2645727860 Winslowiella iniecta B120 Isolate Aphididae
43 2651870110 Izhakiella capsodis N6PO6 Isolate Unclassified
44 2820367663 Unclassified Firmicutes Nt197P3bin105 Isolate Unclassified
45 2871771314 Pantoea sp. Ae16 Isolate Culicidae
46 2898741527 Sphingobacterium sp. xlx-73 Isolate
47 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
48 2940400224 Paenibacillus sp. PastM-2 Isolate Blattidae
49 2957730672 Cronobacter sakazakii MOD1-Md70g Isolate Muscidae
50 2967915117 Cronobacter sakazakii MOD1-Lc10g Isolate Calliphoridae
51 2979682021 Cronobacter turicensis MOD1-Sh41s Isolate Sarcophagidae
52 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
53 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
54 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
55 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
56 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
57 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
58 648276708 Pantoea sp. aB Isolate Unclassified
59 8101676404 Providencia sp. JGM172 Isolate Drosophilidae
60 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
61 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
62 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
63 2507262057 Enterobacteriaceae bacterium FGI 57 Isolate Unclassified
64 2551306516 Enterobacter hormaechei YT3 Isolate Tenebrionidae
65 2590828803 Pedobacter glucosidilyticus DD6b Isolate Daphniidae
66 2873776654 Pedobacter sp. HDW13 Isolate Hydrophilidae
67 2921816052 Cronobacter sakazakii MOD1-Anth48g Isolate Anthomyiidae
68 2937427229 Cronobacter malonaticus MOD1-Md99g Isolate Muscidae
69 2940406939 Paenibacillus sp. PastM-3 Isolate Blattidae
70 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
71 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
72 651324086 Plautia crossota stali symbiont Isolate Unclassified
73 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
74 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
75 2588253732 Klebsiella pneumoniae pneumoniae KP5-1 Isolate Pentatomidae
76 2856068565 Cronobacter sakazakii MOD1-Md35s Isolate Muscidae
77 2896321640 Sphingobacterium sp. xlx-130 Isolate
78 2940221333 Paenibacillus sp. PastF-3 Isolate Blattidae
79 2940425923 Paenibacillus sp. PastH-4 Isolate Blattidae
80 2967924226 Cronobacter malonaticus MOD1-Md25g Isolate Muscidae
81 2970322301 Cronobacter sakazakii MOD1-Md33g Isolate Muscidae
82 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
83 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
84 3300035363 Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - pupa gut Metagenome Plutellidae
85 8004118532 Citrobacter amalonaticus ku-bf3 Isolate Carabidae
86 8101683685 Providencia sp. JGM181 Isolate Drosophilidae
87 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
88 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
89 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
90 2551306531 Enterobacter hormaechei YT2 Isolate Tenebrionidae
91 2833053935 Buttiauxella sp. 3AFRM03 Isolate Cerambycidae
92 2841260384 Providencia alcalifaciens Dmel2 Isolate Drosophilidae
93 2896187957 Providencia stuartii Crippen Isolate Calliphoridae
94 2896330536 Sphingobacterium sp. xlx-96 Isolate
95 2940380068 Paenibacillus sp. PastH-2 Isolate Blattidae
96 2940413413 Paenibacillus sp. PastH-3 Isolate Blattidae
97 2977727922 Cronobacter sakazakii MOD1-Md33s Isolate Muscidae
98 3007994558 Escherichia alba B35 Isolate Tenebrionidae
99 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
100 3300012806 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG Metagenome
101 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
102 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
103 8021535516 Klebsiella sp. Kd70 TUC-EEAOC Isolate Crambidae
104 8100181737 Kosakonia sp. S58 Isolate Curculionidae
105 2597489902 Providencia rettgeri Dmel1 Isolate Drosophilidae
106 2876358570 Cronobacter sakazakii MOD1-Ls15g Isolate Calliphoridae
107 2896350215 Sphingobacterium sp. xlx-183 Isolate
108 2937387794 Cronobacter turicensis MOD1-Sh41g Isolate Sarcophagidae
109 2938192669 Citrobacter sp. TSA-1 Isolate Unclassified
110 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Drosophilidae
111 3300007767 Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut Metagenome Drosophilidae
112 3300012803 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG Metagenome
113 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
114 3300030930 Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 Metagenome Formicidae
115 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
116 8021546568 Klebsiella sp. Kps Isolate Tephritidae
117 8100171289 Kosakonia sp. S42 Isolate Curculionidae
118 8101680043 Providencia sp. JGM178 Isolate Drosophilidae
119 8103002986 Erwinia sp. S38 Isolate Curculionidae
120 8103008710 Erwinia sp. S43 Isolate Curculionidae
121 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
122 2648501209 Winslowiella iniecta B149 Isolate Aphididae
123 2876334352 Cronobacter sakazakii MOD1-Md6g Isolate Muscidae
124 2898991528 Erwinia sp. OLMDLW33 Isolate Anthocoridae
125 2940393498 Paenibacillus sp. PastF-2 Isolate Blattidae
126 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
127 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
128 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_012960 3300042659 Bacteria 20856
2 Ga0466733_032625 3300042659 Bacteria 2869
3 Ga0466733_042935 3300042659 Bacteria 17380
4 Ga0466730_017453 3300042625 Bacteria 55311
5 Ga0466730_039895 3300042625 Bacteria 19290
6 Ga0466730_039992 3300042625 Bacteria 1355215
7 Ga0466704_140612 3300042643 Bacteria 1676
8 Ga0466704_372968 3300042643 Bacteria 3080
9 Ga0466724_23023 3300042649 Bacteria 116535
10 Ga0466725_254201 3300042654 Bacteria 4736
11 Ga0123357_10190736 3300009784 Bacteria 2362
12 Ga0160465_100061 3300012803 Bacteria 120691
13 Ga0160442_100047 3300012806 Bacteria 180728
14 Ga0160472_100068 3300012839 Bacteria 170818
15 Ga0160433_104738 3300012846 Bacteria 2147
16 Ga0160448_100086 3300012854 Bacteria 53508
17 Ga0264413_117682 3300024493 Bacteria 4097
18 Ga0265387_1000006 3300024582 Bacteria 94016
19 Ga0247289_0208 3300035363 Bacteria 12841
20 FGTW_contig30736 2065487013 Bacteria 10026
21 Ga0063521_1006263 3300003973 Bacteria 2824
22 Ga0105005_1008123 3300007505 Unclassified 2495
23 Ga0466711_231951 3300042615 Bacteria 7923
24 Ga0466711_281402 3300042615 Bacteria 2379
25 Ga0466705_301829 3300042612 Bacteria 16147
26 Ga0466733_090286 3300042659 Bacteria 40500
27 Ga0562377_0001 3300056842 Bacteria 5082480
28 Ga0466720_063194 3300042607 Bacteria 3913
29 Ga0466725_045976 3300042654 Bacteria 7283
30 Ga0123353_10082797 3300010167 Bacteria 5161
31 Ga0160441_100452 3300012825 Bacteria 31096
32 Ga0264413_116158 3300024493 Unclassified 5852
33 Ga0316159_11431 3300030930 Bacteria 5545
34 Ga0466690_279025 3300042590 Bacteria 19191
35 FGTW_contig27759 2065487013 Bacteria 1899
36 FGTW_contig31013 2065487013 Bacteria 6850
37 Ga0105005_1015860 3300007505 Bacteria 3091
38 Ga0105553_1042627 3300007767 Bacteria 19474
39 Ga0466711_290366 3300042615 Bacteria 35815
40 Ga0466705_089789 3300042612 Bacteria 3801
41 Ga0466720_004549 3300042607 Bacteria 33303
42 Ga0466722_117139 3300042609 Bacteria 7300
43 Ga0466704_052028 3300042643 Bacteria 20029
44 Ga0160433_100046 3300012846 Bacteria 138039
45 Ga0160457_1000001 3300012858 Bacteria 1192173
46 Ga0264413_117292 3300024493 Bacteria 6365
47 Ga0247290_00158 3300035364 Bacteria 21267
48 Ga0466694_273660 3300042594 Bacteria 2036
49 Ga0466705_107222 3300042612 Bacteria 12906
50 Ga0562379_0001 3300056790 Bacteria 4904077
51 Ga0466704_023056 3300042643 Bacteria 8077
52 Ga0466704_102388 3300042643 Bacteria 7877
53 Ga0466724_41109 3300042649 Bacteria 36081
54 Ga0123353_10226951 3300010167 Bacteria 2915
55 Ga0123353_10399639 3300010167 Bacteria 2046
56 Ga0160444_100760 3300012841 Bacteria 9576
57 Ga0247290_00836 3300035364 Bacteria 4451
58 Ga0466692_174638 3300042591 Bacteria 4041
59 Ga0466705_236644 3300042612 Bacteria 1622
60 Ga0466701_076764 3300042598 Unclassified 1108
61 Ga0466716_340870 3300042605 Bacteria 1420
62 Ga0466731_105715 3300042622 Bacteria 1678
63 Ga0466730_076858 3300042625 Unclassified 26873
64 Ga0466704_115819 3300042643 Bacteria 26827
65 Ga0466709_297009 3300042648 Bacteria 6999
66 Ga0160467_100248 3300012829 Bacteria 66505
67 Ga0466701_011154 3300042598 Bacteria 80559
68 CVPL010L_1000111 3300002932 Bacteria 91591
69 CVPL010L_1005377 3300002932 Unclassified 1304
70 Ga0466711_478583 3300042615 Bacteria 30200
71 Ga0466723_122006 3300042618 Bacteria 2660
72 Ga0562375_0004 3300056856 Bacteria 3010592
73 Ga0562375_0065 3300056856 Bacteria 412749
74 Ga0466713_098270 3300042602 Bacteria 331235
75 Ga0466729_288485 3300042621 Bacteria 1536
76 Ga0466704_221653 3300042643 Bacteria 14003
77 Ga0160468_100087 3300012819 Bacteria 110932
78 Ga0160441_100001 3300012825 Bacteria 1006445
79 Ga0466692_041843 3300042591 Bacteria 17251
80 Ga0466696_016870 3300042596 Bacteria 18403
81 CVPL010L_1000049 3300002932 Unclassified 45580
82 Ga0466705_030269 3300042612 Bacteria 34132
83 Ga0562377_0035 3300056842 Bacteria 679350
84 Ga0466700_462514 3300042600 Bacteria 1174
85 Ga0466707_304425 3300042601 Bacteria 2369
86 Ga0466720_084105 3300042607 Bacteria 11275
87 Ga0466704_082840 3300042643 Bacteria 1983
88 Ga0466704_207486 3300042643 Bacteria 7711
89 Ga0466704_437084 3300042643 Bacteria 2456
90 Ga0466724_20887 3300042649 Bacteria 111293
91 Ga0466727_102193 3300042655 Bacteria 19122
92 Ga0160448_107019 3300012854 Bacteria 2743
93 Ga0316159_10535 3300030930 Bacteria 13646
94 Ga0316159_11520 3300030930 Unclassified 4572
95 Ga0247289_1168 3300035363 Bacteria 2707
96 Ga0466657_023044 3300042582 Bacteria 5630
97 Ga0466690_392447 3300042590 Bacteria 51684
98 Ga0466728_003122 3300042620 Bacteria 1511
99 Ga0466728_451525 3300042620 Bacteria 7599
100 Ga0466713_140012 3300042602 Bacteria 490520
101 Ga0466720_081254 3300042607 Bacteria 15096
102 Ga0466730_043433 3300042625 Unclassified 3239
103 Ga0466730_101469 3300042625 Bacteria 10777
104 Ga0160455_100712 3300012837 Bacteria 13656
105 Ga0160472_100010 3300012839 Bacteria 466892
106 Ga0160433_103227 3300012846 Bacteria 3034
107 Ga0316159_12092 3300030930 Bacteria 2261
108 Ga0466715_026465 3300042616 Bacteria 99999

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00248 Aldo_ket_red Aldo/keto reductase family 16 317 0.95

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.