Protein Family IF03763
Metagenome
Isolate
456
Members
322
Samples
195
Scaffolds
739.12
Avg Length
Representative Sequence
- ID
- 3300012831|Ga0160459_100041|Ga0160459_100041166
- Length
- 787 aa
- Sequence
- MPRIGKCHSRVTRTHAQWRLLFKRWNNEEPTMSSSNDSTEAKCPFHPAGGAGTTNRDWWPKQLRLDLLHQHSPKANPLGADFDYAKAFASLDLAALKKDLAALMTDSQDWWPADFGHYGPLFVRMAWHSAGTYRTGDGRGXXXXGQQRFAPLNSWPDNVSLDKARRLLWPIKQKYGAKISWADLMILTGNVALETMGFKTFGFAGGRVDTWEPDQDVYWGRETKWLGGDVRYAHGDEGVSKPGDQAVLVSDDPADGDKHSRDLENPLAAVQMGLIYVNPEGPDGNPDPVAAARDIRDTFARMAMDDEETVALIAGGHTFGKTHGAGPADNVGDEPEAADFASQGLGWANRFGSGKGADTITSGLEVTWTTTPTKWSGNFFWNLFGYEWELTKSPAGAHQWVAKGAGATIPHAHDPSKKLVPTMLTTDLSLRLDPAYEKISRRFMENPDQFADAFARAWFKLTHRDMGPRARYLGPEVPAEELLWQDPIPAVDHPLVDAKDVAALKAKLLASGLSLAELVGTAWASASTFRGSDMRGGANGARIRLAPQKDWAANQPEQLARVLKTLEGLQAEFNASATGGKTISLADLIVLGGCAAVEQAAKNAGHAQTVPFSPGRMDATQEQTDVQSMAVLEPLADGFRNFVKGNYSVPAETLLVDKAQLLTLSAPEMTALVGGLRALGANVGGSTHGVFGTRKDTLGNDFFTHLLDMGTEWKPVPGHSGQYAAHDRKSGKATWTGTRVDLVFGANAQLRALSEVYASDEPRFVQDFVAAWTKVMNLDRFDLARG*
Sample Types
Isolate
57.2%
Metagenome
42.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Coreidae
21.5%
Unclassified
17.5%
Elmidae
8.8%
Termitidae
8.4%
Anthocoridae
7.4%
Formicidae
5.7%
Culicidae
5.7%
Apidae
5.1%
Curculionidae
2.7%
Armadillidiidae
2.7%
Kalotermitidae
2.4%
Tenebrionidae
2.0%
Ixodidae
1.3%
Hydrophilidae
1.3%
Largidae
0.7%
Scarabaeidae
0.7%
Rhinotermitidae
0.7%
Argasidae
0.7%
Termopsidae
0.7%
Chironomidae
0.3%
Trigoniulidae
0.3%
Cerambycidae
0.3%
Berytidae
0.3%
Cixiidae
0.3%
Pentatomidae
0.3%
Nephropidae
0.3%
Lysianassidae
0.3%
Passalidae
0.3%
Cambaridae
0.3%
Reduviidae
0.3%
Alydidae
0.3%
Taxonomy
Archaea
0
Bacteria
447
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820909719 | Unclassified Actinobacteria Emb289P4bin20 | Isolate | Unclassified |
| 2 | 2856966858 | Pseudonocardia sp. Ae263_Ps1 | Isolate | Formicidae |
| 3 | 2864761044 | Stenotrophomonas rhizophilia S00008 | Isolate | Elmidae |
| 4 | 2864831662 | Chryseobacterium sediminis S00068 | Isolate | Elmidae |
| 5 | 2874209778 | Francisella tularensis holarctica FT16C-B1 | Isolate | Ixodidae |
| 6 | 2894649344 | Allomuricauda alvinocaridis SCR12 | Isolate | Unclassified |
| 7 | 2894932631 | Leucobacter sp. OAMLP11 | Isolate | Anthocoridae |
| 8 | 2894966443 | Leucobacter sp. OLCALW19 | Isolate | Anthocoridae |
| 9 | 2902451016 | Photobacterium leiognathi mandapamensis ajapo.4.1 | Isolate | Unclassified |
| 10 | 2904728850 | Flavobacterium sp. xlx-214 | Isolate | |
| 11 | 2920412021 | Bombella sp. ESL0387 | Isolate | Apidae |
| 12 | 2506210010 | Francisella tularensis tularensis FSC041 | Isolate | |
| 13 | 2506210015 | Francisella tularensis holarctica FSC185 | Isolate | |
| 14 | 2515154100 | Streptomyces sp. MspMP-M5 | Isolate | Unclassified |
| 15 | 2515154104 | Streptomyces sp. KhCrAH-244 | Isolate | Unclassified |
| 16 | 2519899622 | Pseudomonas sp. Ag1 | Isolate | Culicidae |
| 17 | 2524023214 | Leucobacter chironomi DSM 19883 | Isolate | Chironomidae |
| 18 | 2675903497 | Pseudonocardia sp. EC080610-09 | Isolate | Formicidae |
| 19 | 2703719240 | Serratia marcescens ano2 | Isolate | Unclassified |
| 20 | 2711768164 | Tritonibacter mobilis S1942 | Isolate | Unclassified |
| 21 | 2816332545 | Tritonibacter mobilis S1923 | Isolate | Unclassified |
| 22 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 23 | 3003869270 | Paraburkholderia sp. PGU16 | Isolate | Largidae |
| 24 | 3007473699 | Pseudomonas sp. S30 | Isolate | Curculionidae |
| 25 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 26 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 27 | 637000113 | Francisella tularensis tularensis FSC 198 | Isolate | |
| 28 | 647000328 | Streptomyces sp. ACT-1 XylebKG-1 | Isolate | Curculionidae |
| 29 | 649989992 | Pseudonocardia sp. P1 | Isolate | Formicidae |
| 30 | 8011329375 | Pseudomonas sp. S31 | Isolate | Curculionidae |
| 31 | 8011357093 | Pseudomonas schmalbachii Milli4 | Isolate | Trigoniulidae |
| 32 | 8020009074 | Elizabethkingia anophelis MSU001 | Isolate | Culicidae |
| 33 | 8024037630 | Caballeronia zhejiangensis A33_M4_a | Isolate | Coreidae |
| 34 | 8025685901 | Caballeronia fortuita LZ035 | Isolate | Coreidae |
| 35 | 8025756023 | Caballeronia peredens LZ002 | Isolate | Coreidae |
| 36 | 8053361298 | Streptomyces formicae 1H-GS9 | Isolate | Unclassified |
| 37 | 8074809037 | Bombella apis MRM1 | Isolate | Apidae |
| 38 | 8078130113 | Caballeronia sp. INDeC2 | Isolate | Coreidae |
| 39 | 8102102351 | Caballeronia sp. INML1 | Isolate | Coreidae |
| 40 | 8102161003 | Caballeronia sp. LZ002 | Isolate | Coreidae |
| 41 | 8102174626 | Caballeronia sp. LZ024 | Isolate | Coreidae |
| 42 | 2820807258 | Unclassified Actinobacteria Nt197P3bin90 | Isolate | Unclassified |
| 43 | 2820889385 | Unclassified Actinobacteria Lab288P1bin133 | Isolate | Unclassified |
| 44 | 2820926697 | Unclassified Actinobacteria Emb289P3bin125 | Isolate | Unclassified |
| 45 | 2864870719 | Comamonas odontotermitis S00124 | Isolate | Elmidae |
| 46 | 2864937364 | Acidovorax soli S00198 | Isolate | Elmidae |
| 47 | 2864948220 | Elizabethkingia anophelis S00205 | Isolate | Elmidae |
| 48 | 2871595141 | Francisella tularensis 503 | Isolate | Ixodidae |
| 49 | 2873776654 | Pedobacter sp. HDW13 | Isolate | Hydrophilidae |
| 50 | 2891720358 | Azoarcus nasutitermitis CC-YHH838 | Isolate | Unclassified |
| 51 | 2894944011 | Leucobacter sp. OLAS13 | Isolate | Anthocoridae |
| 52 | 2922113941 | Serratia sp. OLEL1 | Isolate | Anthocoridae |
| 53 | 2937751072 | Serratia sp. OLMTLW26 | Isolate | Anthocoridae |
| 54 | 2958255616 | Serratia marcescens TM | Isolate | |
| 55 | 2965197371 | Serratia sp. OLCL1 | Isolate | Anthocoridae |
| 56 | 2671180625 | Pseudonocardia sp. EC080619-01 | Isolate | Formicidae |
| 57 | 2816332503 | Tritonibacter mobilis S1611 | Isolate | Unclassified |
| 58 | 2820106212 | Unclassified Proteobacteria Emb289P4bin44 | Isolate | Unclassified |
| 59 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 60 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 61 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 62 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 63 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 64 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 65 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 66 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 67 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 68 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 69 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 70 | 8025650824 | Caballeronia hypogeia LZ032 | Isolate | Coreidae |
| 71 | 8025671076 | Caballeronia cordobensis LZ034LL | Isolate | Coreidae |
| 72 | 8074810961 | Bombella apis SME1 | Isolate | Apidae |
| 73 | 8102047609 | Caballeronia sp. GACF5 | Isolate | Coreidae |
| 74 | 8102074813 | Caballeronia sp. GAWG1-1 | Isolate | Coreidae |
| 75 | 8102117041 | Caballeronia sp. INML3 | Isolate | Coreidae |
| 76 | 8102131453 | Caballeronia sp. INML5 | Isolate | Coreidae |
| 77 | 8102138357 | Caballeronia sp. INSB1 | Isolate | Coreidae |
| 78 | 8102216467 | Caballeronia sp. LZ033 | Isolate | Coreidae |
| 79 | 8102230706 | Caballeronia sp. LZ035 | Isolate | Coreidae |
| 80 | 8102239244 | Caballeronia sp. LZ043 | Isolate | Coreidae |
| 81 | 2820842553 | Unclassified Actinobacteria Lab288P4bin104 | Isolate | Unclassified |
| 82 | 2834143536 | Parasaccharibacter apium AS1 | Isolate | Apidae |
| 83 | 2834160066 | Parasaccharibacter apium B8 | Isolate | Apidae |
| 84 | 2847305884 | Microbacterium protaetiae DFW100M-13 | Isolate | Scarabaeidae |
| 85 | 2847708326 | Serratia liquefaciens P2ACOL2 | Isolate | Cerambycidae |
| 86 | 2856960404 | Pseudonocardia sp. Ae706_Ps2 | Isolate | Formicidae |
| 87 | 2856973192 | Pseudonocardia sp. Ae331_Ps2 | Isolate | Formicidae |
| 88 | 2859970369 | Pseudonocardia sp. Ae717_Ps2 | Isolate | Formicidae |
| 89 | 2862784999 | Streptomyces sp. M41 | Isolate | Unclassified |
| 90 | 2863397684 | Micromonospora polyrhachis DSM 45886 (Annotation) (version 2) | Isolate | Unclassified |
| 91 | 2864847319 | Pseudomonas alcaligenes S00099 | Isolate | Elmidae |
| 92 | 2864914039 | Chromobacterium alkanivorans S00172 | Isolate | Elmidae |
| 93 | 2864923010 | Elizabethkingia anophelis S00177 | Isolate | Elmidae |
| 94 | 2864988360 | Chromobacterium alkanivorans S00296 | Isolate | Elmidae |
| 95 | 2874504452 | Serratia marcescens ADJS-2C_Purple | Isolate | Unclassified |
| 96 | 2894981435 | Leucobacter sp. OLDS2 | Isolate | Anthocoridae |
| 97 | 2899194184 | Bombella sp. ESL0378 | Isolate | Apidae |
| 98 | 2902469402 | Photobacterium lucens CAIM 1937 | Isolate | Unclassified |
| 99 | 2920413932 | Bombella sp. ESL0380 | Isolate | Apidae |
| 100 | 2931425734 | Nocardioides sp. J2M5 | Isolate | |
| 101 | 2515154106 | Streptomyces sp. FxanaD5 | Isolate | Unclassified |
| 102 | 2547132042 | Pseudonocardia sp. P2 | Isolate | Formicidae |
| 103 | 2585428048 | Colwellia sp. NBT2012 | Isolate | |
| 104 | 2718217924 | Pseudonocardia sp. HH130630-07 | Isolate | Formicidae |
| 105 | 2772190761 | Rhodococcus rhodnii NRRL B-16535 | Isolate | Unclassified |
| 106 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 107 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 108 | 2996406003 | Serratia sp. OLJL1 | Isolate | Anthocoridae |
| 109 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 110 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 111 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 112 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 113 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 114 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 115 | 8023724303 | Caballeronia zhejiangensis LP003 | Isolate | Coreidae |
| 116 | 8024001094 | Caballeronia sp. TF1N1 | Isolate | Berytidae |
| 117 | 8025694439 | Caballeronia cordobensis LZ033 | Isolate | Coreidae |
| 118 | 8025701579 | Caballeronia telluris LZ031 | Isolate | Coreidae |
| 119 | 8052469819 | Pseudomonas putida DZ-F23 | Isolate | |
| 120 | 8101967387 | Caballeronia sp. AAUFL_F3_KS11A | Isolate | Coreidae |
| 121 | 8102007614 | Caballeronia sp. ATUFL_M1_KS5A | Isolate | Coreidae |
| 122 | 8102041249 | Caballeronia sp. GACF4 | Isolate | Coreidae |
| 123 | 8102087471 | Caballeronia sp. GAWG2-1 | Isolate | Coreidae |
| 124 | 8102201977 | Caballeronia sp. LZ031 | Isolate | Coreidae |
| 125 | 8102264549 | Caballeronia sp. NCF2 | Isolate | Coreidae |
| 126 | 2820863028 | Unclassified Actinobacteria Lab288P3bin164 | Isolate | Unclassified |
| 127 | 2852016966 | Micromonospora polyrhachis DSM 45886 | Isolate | Unclassified |
| 128 | 2864751016 | Pseudomonas oryzihabitans S00005 | Isolate | Elmidae |
| 129 | 2864968865 | Paucibacter oligotrophus S00239 | Isolate | Elmidae |
| 130 | 2868883784 | Photobacterium leiognathi mandapamensis AJ-1a | Isolate | Unclassified |
| 131 | 2873565274 | Diaphorobacter sp. HDW4A | Isolate | Hydrophilidae |
| 132 | 2883683260 | Protaetiibacter larvae KACC 19322 | Isolate | Scarabaeidae |
| 133 | 2894900265 | Leucobacter sp. OLTLW20 | Isolate | Anthocoridae |
| 134 | 2894929448 | Leucobacter sp. OAMSW11 | Isolate | Anthocoridae |
| 135 | 2898589227 | Actinomadura macrotermitis RB68 | Isolate | Termitidae |
| 136 | 2617270844 | Dyella sp. HyOG | Isolate | Cixiidae |
| 137 | 2671180705 | Pseudoalteromonas piscicida S2040 | Isolate | Unclassified |
| 138 | 2772190782 | Francisella persica ATCC VR-331 | Isolate | Argasidae |
| 139 | 2791354941 | Bombella intestini R-52487 | Isolate | Unclassified |
| 140 | 2820101058 | Unclassified Proteobacteria Emb289P4bin76 | Isolate | Unclassified |
| 141 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 142 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 143 | 2998907766 | Penaeicola halotolerans LMIT005 | Isolate | |
| 144 | 3007478678 | Pseudomonas sp. S37 | Isolate | Curculionidae |
| 145 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 146 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 147 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 148 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 149 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 150 | 637000219 | Pseudomonas entomophila L48 | Isolate | Unclassified |
| 151 | 8025658853 | Caballeronia temeraria LZ065 | Isolate | Coreidae |
| 152 | 8025708040 | Caballeronia jiangsuensis LZ029 | Isolate | Coreidae |
| 153 | 8035326735 | Pseudomonas prosekii A2-NA13 | Isolate | Curculionidae |
| 154 | 8101994502 | Caballeronia sp. ATUFL_F2_KS42 | Isolate | Coreidae |
| 155 | 8102124461 | Caballeronia sp. INML3B | Isolate | Coreidae |
| 156 | 8102193924 | Caballeronia sp. LZ029 | Isolate | Coreidae |
| 157 | 8102312426 | Caballeronia sp. AAUFL_F1_KS47 | Isolate | Coreidae |
| 158 | 8118075156 | Actinosynnema pretiosum DSM 44131 | Isolate | Unclassified |
| 159 | 2820882373 | Unclassified Actinobacteria Lab288P1bin45 | Isolate | Unclassified |
| 160 | 2838140227 | Dyella sp. OAE510 | Isolate | Unclassified |
| 161 | 2843904799 | Shewanella khirikhana TH2012 | Isolate | Unclassified |
| 162 | 2847090942 | Elizabethkingia anophelis Ag1 | Isolate | Culicidae |
| 163 | 2856652821 | Actinomadura rubteroloni RB29 | Isolate | Unclassified |
| 164 | 2856671350 | Pseudonocardia sp. Ae356_Ps1 | Isolate | Formicidae |
| 165 | 2856947901 | Pseudonocardia sp. Ae168_Ps1 | Isolate | Formicidae |
| 166 | 2864882932 | Chryseobacterium shingense S00136 | Isolate | Elmidae |
| 167 | 2864891731 | Chryseobacterium defluvii S00151 | Isolate | Elmidae |
| 168 | 2864899338 | Mycobacteroides chelonae S00154 | Isolate | Elmidae |
| 169 | 2873196663 | Streptomyces capitiformicae 1H-SSA4 | Isolate | Formicidae |
| 170 | 2908241010 | Streptomyces sp. HF10 | Isolate | Termitidae |
| 171 | 2912817845 | Streptomyces griseus SID164 | Isolate | |
| 172 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 173 | 2585427605 | Colwellia sp. MT2012 | Isolate | |
| 174 | 2687453786 | Chryseobacterium culicis DSM 23031 | Isolate | Unclassified |
| 175 | 2724678956 | Methylobacterium sp. GXS13 | Isolate | Unclassified |
| 176 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 177 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 178 | 2978161719 | Serratia marcescens KZ2 | Isolate | Apidae |
| 179 | 3006468911 | Streptomyces sp. RB17 | Isolate | Termitidae |
| 180 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 181 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 182 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 183 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 184 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 185 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 186 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 187 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 188 | 8025740903 | Caballeronia zhejiangensis LZ008 | Isolate | Coreidae |
| 189 | 8069511479 | Arthrobacter ipsi IA7 | Isolate | Curculionidae |
| 190 | 8069748016 | Caballeronia sp. LP003 | Isolate | Coreidae |
| 191 | 8102033761 | Caballeronia sp. AZ7_KS35 | Isolate | Coreidae |
| 192 | 8102094248 | Caballeronia sp. GaOx3 | Isolate | Coreidae |
| 193 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 194 | 8102145433 | Caballeronia sp. LP006 | Isolate | Coreidae |
| 195 | 8102186987 | Caballeronia sp. LZ028 | Isolate | Coreidae |
| 196 | 8102223607 | Caballeronia sp. LZ034LL | Isolate | Coreidae |
| 197 | 8102286609 | Caballeronia sp. NCTM5 | Isolate | Coreidae |
| 198 | 2820931684 | Unclassified Actinobacteria Emb289P1bin89 | Isolate | Unclassified |
| 199 | 2856954254 | Pseudonocardia sp. Ae505_Ps2 | Isolate | Formicidae |
| 200 | 2864812326 | Chitinimonas taiwanensis S00057 | Isolate | Elmidae |
| 201 | 2864836148 | Arcicella rosea S00070 | Isolate | Elmidae |
| 202 | 2864859030 | Chromobacterium alkanivorans S00115 | Isolate | Elmidae |
| 203 | 2864944480 | Pseudomonas fluvialis S00202 | Isolate | Elmidae |
| 204 | 2864960361 | Comamonas odontotermitis S00229 | Isolate | Elmidae |
| 205 | 2868169047 | Comamonas aquatica S00077 | Isolate | Elmidae |
| 206 | 2871564055 | Francisella tularensis holarctica FT9C-G7 | Isolate | Ixodidae |
| 207 | 2874203443 | Francisella tularensis holarctica FT8C-4F | Isolate | Ixodidae |
| 208 | 2878947168 | Serratia marcescens ADJS-2D_White | Isolate | Unclassified |
| 209 | 2894897082 | Leucobacter sp. OLCS4 | Isolate | Anthocoridae |
| 210 | 2894974975 | Leucobacter sp. OLIS6 | Isolate | Anthocoridae |
| 211 | 2900368070 | Nocardia aurantia RB56 | Isolate | Termitidae |
| 212 | 2902438364 | Photobacterium damselae Hep-2a-11 | Isolate | Unclassified |
| 213 | 2912749649 | Streptomyces sp. GS7 | Isolate | Termitidae |
| 214 | 2937735258 | Serratia marcescens KZ11 | Isolate | Apidae |
| 215 | 2961247850 | Serratia sp. OLAL2 | Isolate | Anthocoridae |
| 216 | 2529292732 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 217 | 2548876789 | Xanthomonas sacchari NCPPB 4393 | Isolate | |
| 218 | 2818991478 | Micromonospora palomenae DSM 102131 | Isolate | Pentatomidae |
| 219 | 2987233858 | Stutzerimonas stutzeri AR9-4 | Isolate | Unclassified |
| 220 | 3006461590 | Streptomyces sp. RB5 | Isolate | Termitidae |
| 221 | 3006667155 | Streptomyces sp. SID9727 | Isolate | |
| 222 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 223 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 224 | 3300012806 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG | Metagenome | |
| 225 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 226 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 227 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 228 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 229 | 8004307473 | Serratia sp. OLIL2 | Isolate | Anthocoridae |
| 230 | 8004571736 | Serratia sp. OLDL1 | Isolate | Anthocoridae |
| 231 | 8023757577 | Caballeronia peredens LP006 | Isolate | Coreidae |
| 232 | 8023764196 | Caballeronia peredens LZ001 | Isolate | Coreidae |
| 233 | 8025678175 | Caballeronia hypogeia LZ043 | Isolate | Coreidae |
| 234 | 8025728939 | Caballeronia telluris LZ024 | Isolate | Coreidae |
| 235 | 8025747911 | Caballeronia peredens LZ003 | Isolate | Coreidae |
| 236 | 8035321120 | Pseudomonas prosekii A2-NA12 | Isolate | Curculionidae |
| 237 | 8069755105 | Caballeronia sp. LZ003 | Isolate | Coreidae |
| 238 | 8101951471 | Caballeronia sp. AAUFL_F1_KS45 | Isolate | Coreidae |
| 239 | 8101974301 | Caballeronia sp. ASUFL_F2_KS49 | Isolate | Coreidae |
| 240 | 8101981714 | Caballeronia sp. ATUFL_F1_KS39 | Isolate | Coreidae |
| 241 | 8102026984 | Caballeronia sp. AZ1_KS37 | Isolate | Coreidae |
| 242 | 8102067727 | Caballeronia sp. GAFFF3 | Isolate | Coreidae |
| 243 | 8114076984 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 244 | 2828505942 | Spirobacillus cienkowskii binning01 | Isolate | Unclassified |
| 245 | 2834165886 | Saccharibacter sp. M18 | Isolate | Apidae |
| 246 | 2835143510 | Yoonia maritima YPC211 | Isolate | Nephropidae |
| 247 | 2844251356 | Photobacterium leiognathi mandapamensis ajapo.3.1 | Isolate | Unclassified |
| 248 | 2856882415 | Pseudonocardia sp. Ae406_Ps2 | Isolate | Formicidae |
| 249 | 2859977607 | Pseudonocardia sp. Ae707_Ps1 | Isolate | Formicidae |
| 250 | 2864739902 | Pseudomonas viridiflavia S00001 | Isolate | Elmidae |
| 251 | 2864788197 | Elizabethkingia anophelis S00027 | Isolate | Elmidae |
| 252 | 2864822740 | Chryseobacterium shigense S00064 | Isolate | Elmidae |
| 253 | 2873562573 | Thermomonas sp. HDW16 | Isolate | Hydrophilidae |
| 254 | 2873571580 | Diaphorobacter sp. HDW4B | Isolate | Hydrophilidae |
| 255 | 2874434233 | Serratia marcescens ADJS-2C_Red | Isolate | Unclassified |
| 256 | 2900349738 | Photobacterium lucens CAIM 1938 | Isolate | Unclassified |
| 257 | 2900354037 | Nocardia macrotermitis RB20 | Isolate | Termitidae |
| 258 | 2901819457 | Bombella sp. ESL0385 | Isolate | Apidae |
| 259 | 2961232173 | Serratia sp. OLLOLW30 | Isolate | Anthocoridae |
| 260 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 261 | 2501651205 | Colwellia sp. MT41 | Isolate | Lysianassidae |
| 262 | 2648501322 | Streptomyces sp. SA3_actF | Isolate | Unclassified |
| 263 | 2718217944 | Serratia marcescens AS1 | Isolate | Culicidae |
| 264 | 2806310685 | Francisella persica ATCC VR-331 | Isolate | Argasidae |
| 265 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 266 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 267 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 268 | 2970791725 | Serratia sp. OLBL1 | Isolate | Anthocoridae |
| 269 | 2996467878 | Serratia sp. OLFL2 | Isolate | Anthocoridae |
| 270 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 271 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 272 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 273 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 274 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 275 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 276 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 277 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 278 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 279 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 280 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 281 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 282 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 283 | 8025716094 | Caballeronia zhejiangensis LZ028 | Isolate | Coreidae |
| 284 | 8046957834 | Streptomyces coacervatus JCM 17138 | Isolate | Unclassified |
| 285 | 8101960468 | Caballeronia sp. AAUFL_F2_KS46 | Isolate | Coreidae |
| 286 | 8101988189 | Caballeronia sp. ATUFL_F1_KS4A | Isolate | Coreidae |
| 287 | 8102014801 | Caballeronia sp. ATUFL_M2_KS44 | Isolate | Coreidae |
| 288 | 8102060671 | Caballeronia sp. GAFFF2 | Isolate | Coreidae |
| 289 | 8102152052 | Caballeronia sp. LZ001 | Isolate | Coreidae |
| 290 | 8102208438 | Caballeronia sp. LZ032 | Isolate | Coreidae |
| 291 | 8102251710 | Caballeronia sp. LZ065 | Isolate | Coreidae |
| 292 | 8102279326 | Caballeronia sp. NCTM1 | Isolate | Coreidae |
| 293 | 2831736028 | Parasaccharibacter apium A29 | Isolate | Apidae |
| 294 | 2864808494 | Chitinimonas taiwanensis S00056 | Isolate | Elmidae |
| 295 | 2864926767 | Pseudomonas nitritireducens S00179 | Isolate | Elmidae |
| 296 | 2864934081 | Brevundimonas vesicularis S00192 | Isolate | Elmidae |
| 297 | 2889908211 | Bowmanella denitrificans JL63 | Isolate | Unclassified |
| 298 | 2894935787 | Leucobacter sp. OLJS4 | Isolate | Anthocoridae |
| 299 | 2918394494 | Microbacterium imperiale DSM 20530 | Isolate | Unclassified |
| 300 | 2958471994 | Flavobacterium sp. xlx-221 | Isolate | Cambaridae |
| 301 | 2961206375 | Serratia sp. OMLW3 | Isolate | Anthocoridae |
| 302 | 2545824723 | Rhodococcus rhodnii LMG 5362 | Isolate | Reduviidae |
| 303 | 2597489944 | Caballeronia insecticola RPE64 | Isolate | Alydidae |
| 304 | 2703719239 | Serratia marcescens ano1 | Isolate | Unclassified |
| 305 | 2751185679 | Parasaccharibacter apium G7_7_3c | Isolate | Apidae |
| 306 | 3003878002 | Paraburkholderia sp. PGU19 | Isolate | Largidae |
| 307 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 308 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 309 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 310 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 311 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 312 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 313 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 314 | 8004285568 | Serratia sp. OLHL2 | Isolate | Anthocoridae |
| 315 | 8004541719 | Serratia marcescens KZ19 | Isolate | Apidae |
| 316 | 8004582426 | Serratia sp. OSPLW9 | Isolate | Anthocoridae |
| 317 | 8035422605 | Pseudomonas monteilii CY06 | Isolate | |
| 318 | 8067071256 | Microbispora camponoti 2C-HV3 | Isolate | Formicidae |
| 319 | 8069763219 | Caballeronia sp. LZ008 | Isolate | Coreidae |
| 320 | 8074812948 | Bombella apis MRM1 | Isolate | Apidae |
| 321 | 8102001125 | Caballeronia sp. ATUFL_F2_KS9A | Isolate | Coreidae |
| 322 | 8102271933 | Caballeronia sp. NCF4 | Isolate | Coreidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0562377_0070 | 3300056842 | Bacteria | 439417 |
| 2 | Ga0562377_1005 | 3300056842 | Bacteria | 34895 |
| 3 | Ga0123357_10034718 | 3300009784 | Bacteria | 6856 |
| 4 | Ga0123355_10074311 | 3300009826 | Bacteria | 5445 |
| 5 | Ga0160464_100098 | 3300012805 | Bacteria | 100747 |
| 6 | Ga0466713_022244 | 3300042602 | Bacteria | 177208 |
| 7 | Ga0466697_008902 | 3300042611 | Bacteria | 17214 |
| 8 | DPOL_contig00576 | 2035918003 | Unclassified | 31823 |
| 9 | IMNBGM34_c000494 | 3300000036 | Bacteria | 10550 |
| 10 | Ga0160446_100698 | 3300012835 | Bacteria | 11222 |
| 11 | Ga0160455_101230 | 3300012837 | Bacteria | 8454 |
| 12 | Ga0160445_100310 | 3300012847 | Bacteria | 29578 |
| 13 | Ga0160435_1000597 | 3300012857 | Bacteria | 10754 |
| 14 | Ga0160436_1002298 | 3300012861 | Bacteria | 4922 |
| 15 | Ga0415639_014760 | 3300038395 | Bacteria | 15660 |
| 16 | Ga0415639_033613 | 3300038395 | Bacteria | 8606 |
| 17 | Ga0466701_011154 | 3300042598 | Bacteria | 80559 |
| 18 | Ga0466724_02699 | 3300042649 | Bacteria | 72032 |
| 19 | Ga0466724_22119 | 3300042649 | Bacteria | 19241 |
| 20 | Ga0466724_56547 | 3300042649 | Bacteria | 93236 |
| 21 | Ga0466725_200156 | 3300042654 | Bacteria | 48360 |
| 22 | Ga0562376_0896 | 3300056857 | Bacteria | 46911 |
| 23 | Ga0562376_1118 | 3300056857 | Bacteria | 39910 |
| 24 | Ga0123357_10068432 | 3300009784 | Bacteria | 4724 |
| 25 | Ga0123355_10006816 | 3300009826 | Bacteria | 16996 |
| 26 | Ga0123356_10025882 | 3300010049 | Bacteria | 5515 |
| 27 | Ga0123356_10065719 | 3300010049 | Bacteria | 3394 |
| 28 | Ga0160466_100008 | 3300012809 | Bacteria | 463729 |
| 29 | Ga0466701_082307 | 3300042598 | Bacteria | 68565 |
| 30 | IMNBGM34_c001643 | 3300000036 | Bacteria | 3669 |
| 31 | JGI24705J35276_12234608 | 3300002504 | Bacteria | 5668 |
| 32 | Ga0160468_100139 | 3300012819 | Bacteria | 68423 |
| 33 | Ga0160468_101330 | 3300012819 | Bacteria | 6312 |
| 34 | Ga0160459_100025 | 3300012831 | Bacteria | 346491 |
| 35 | Ga0160446_100031 | 3300012835 | Bacteria | 163435 |
| 36 | Ga0160446_100168 | 3300012835 | Bacteria | 50757 |
| 37 | Ga0160472_100063 | 3300012839 | Bacteria | 179495 |
| 38 | Ga0160472_100254 | 3300012839 | Bacteria | 62252 |
| 39 | Ga0160472_100380 | 3300012839 | Unclassified | 37122 |
| 40 | Ga0160433_100035 | 3300012846 | Bacteria | 160128 |
| 41 | Ga0160435_1001143 | 3300012857 | Bacteria | 6897 |
| 42 | Ga0160457_1000001 | 3300012858 | Bacteria | 1192173 |
| 43 | Ga0466692_078497 | 3300042591 | Bacteria | 7033 |
| 44 | Ga0466691_125495 | 3300042593 | Bacteria | 2658 |
| 45 | Ga0466699_375063 | 3300042597 | Bacteria | 2920 |
| 46 | Ga0466734_000296 | 3300042623 | Bacteria | 4655 |
| 47 | Ga0466724_30115 | 3300042649 | Bacteria | 246830 |
| 48 | Ga0466724_34256 | 3300042649 | Bacteria | 39348 |
| 49 | Ga0466725_022961 | 3300042654 | Bacteria | 80127 |
| 50 | Ga0466725_144756 | 3300042654 | Bacteria | 81147 |
| 51 | Ga0466725_301911 | 3300042654 | Bacteria | 6297 |
| 52 | Ga0466725_314349 | 3300042654 | Bacteria | 7936 |
| 53 | Ga0562378_0011 | 3300056814 | Bacteria | 1075031 |
| 54 | Ga0123355_10007091 | 3300009826 | Bacteria | 16709 |
| 55 | Ga0123355_10130862 | 3300009826 | Bacteria | 3867 |
| 56 | Ga0123353_10000189 | 3300010167 | Bacteria | 78133 |
| 57 | Ga0160465_100263 | 3300012803 | Unclassified | 37076 |
| 58 | Ga0466701_029143 | 3300042598 | Bacteria | 49732 |
| 59 | Ga0466722_253481 | 3300042609 | Bacteria | 3132 |
| 60 | DPOL_contig01078 | 2035918003 | Bacteria | 15392 |
| 61 | Ga0466711_097490 | 3300042615 | Bacteria | 4437 |
| 62 | Ga0466723_186104 | 3300042618 | Bacteria | 14358 |
| 63 | Ga0160432_100233 | 3300012818 | Bacteria | 47606 |
| 64 | Ga0160431_100375 | 3300012828 | Bacteria | 22499 |
| 65 | Ga0160459_100115 | 3300012831 | Bacteria | 64699 |
| 66 | Ga0160472_103828 | 3300012839 | Bacteria | 2834 |
| 67 | Ga0160443_100131 | 3300012848 | Bacteria | 111815 |
| 68 | Ga0415639_135386 | 3300038395 | Bacteria | 3388 |
| 69 | Ga0466657_206923 | 3300042582 | Bacteria | 3304 |
| 70 | Ga0466693_014093 | 3300042592 | Bacteria | 2211 |
| 71 | Ga0466730_018932 | 3300042625 | Bacteria | 159047 |
| 72 | Ga0466730_054823 | 3300042625 | Bacteria | 5831 |
| 73 | Ga0466703_394519 | 3300042636 | Bacteria | 6552 |
| 74 | Ga0466724_06397 | 3300042649 | Bacteria | 17522 |
| 75 | Ga0466708_129716 | 3300042652 | Bacteria | 2594 |
| 76 | Ga0466725_260868 | 3300042654 | Bacteria | 8777 |
| 77 | Ga0466697_093725 | 3300042611 | Bacteria | 3958 |
| 78 | Ga0562379_0010 | 3300056790 | Bacteria | 1659178 |
| 79 | Ga0123357_10007316 | 3300009784 | Bacteria | 13629 |
| 80 | Ga0123355_10041717 | 3300009826 | Bacteria | 7472 |
| 81 | Ga0123356_10000934 | 3300010049 | Bacteria | 32295 |
| 82 | Ga0123356_10090393 | 3300010049 | Bacteria | 2915 |
| 83 | Ga0123353_10069140 | 3300010167 | Bacteria | 5673 |
| 84 | Ga0123354_10037533 | 3300010882 | Bacteria | 7540 |
| 85 | Ga0160464_100138 | 3300012805 | Bacteria | 79565 |
| 86 | Ga0160466_100304 | 3300012809 | Bacteria | 30746 |
| 87 | Ga0160470_100076 | 3300012813 | Bacteria | 133554 |
| 88 | Meta3P_1004722 | 3300002464 | Unclassified | 13297 |
| 89 | CVPL005L_10000006 | 3300002938 | Bacteria | 217355 |
| 90 | Ga0123357_10000017 | 3300009784 | Bacteria | 142899 |
| 91 | Ga0123357_10000021 | 3300009784 | Bacteria | 137168 |
| 92 | Ga0123357_10002616 | 3300009784 | Bacteria | 20228 |
| 93 | Ga0466710_360418 | 3300042613 | Bacteria | 114288 |
| 94 | Ga0466726_205640 | 3300042619 | Bacteria | 14952 |
| 95 | Ga0160446_100861 | 3300012835 | Bacteria | 8514 |
| 96 | Ga0160444_100021 | 3300012841 | Bacteria | 297202 |
| 97 | Ga0160444_100224 | 3300012841 | Bacteria | 48570 |
| 98 | Ga0160444_100548 | 3300012841 | Bacteria | 14741 |
| 99 | Ga0160433_100006 | 3300012846 | Bacteria | 359584 |
| 100 | Ga0160443_100030 | 3300012848 | Bacteria | 361144 |
| 101 | Ga0160443_100284 | 3300012848 | Bacteria | 48969 |
| 102 | Ga0160447_100186 | 3300012849 | Bacteria | 38002 |
| 103 | Ga0160430_103330 | 3300012852 | Bacteria | 4514 |
| 104 | Ga0160448_101241 | 3300012854 | Unclassified | 8315 |
| 105 | Ga0466691_121346 | 3300042593 | Bacteria | 4145 |
| 106 | Ga0466734_115735 | 3300042623 | Bacteria | 2373 |
| 107 | Ga0466730_024232 | 3300042625 | Bacteria | 195834 |
| 108 | Ga0466730_059887 | 3300042625 | Bacteria | 18954 |
| 109 | Ga0466704_431977 | 3300042643 | Bacteria | 3046 |
| 110 | Ga0466724_52085 | 3300042649 | Bacteria | 154897 |
| 111 | Ga0466725_276852 | 3300042654 | Bacteria | 8004 |
| 112 | Ga0466727_085772 | 3300042655 | Bacteria | 22474 |
| 113 | Ga0562376_2397 | 3300056857 | Bacteria | 22342 |
| 114 | Ga0123356_10000148 | 3300010049 | Bacteria | 78821 |
| 115 | Ga0123356_10116051 | 3300010049 | Bacteria | 2595 |
| 116 | Ga0160471_100042 | 3300012812 | Unclassified | 177018 |
| 117 | Ga0466701_022466 | 3300042598 | Bacteria | 41751 |
| 118 | Ga0466701_042734 | 3300042598 | Bacteria | 45982 |
| 119 | Ga0466707_367608 | 3300042601 | Bacteria | 10590 |
| 120 | JGI24695J34938_10003298 | 3300002450 | Bacteria | 11374 |
| 121 | Meta3P_1004613 | 3300002464 | Bacteria | 6754 |
| 122 | JGI24705J35276_12237217 | 3300002504 | Bacteria | 10198 |
| 123 | Ga0160453_100383 | 3300012814 | Bacteria | 37212 |
| 124 | Ga0160441_100254 | 3300012825 | Bacteria | 52023 |
| 125 | Ga0160431_101222 | 3300012828 | Bacteria | 7574 |
| 126 | Ga0160459_100042 | 3300012831 | Bacteria | 210871 |
| 127 | Ga0160472_100202 | 3300012839 | Bacteria | 74662 |
| 128 | Ga0160444_100346 | 3300012841 | Bacteria | 27318 |
| 129 | Ga0160430_100004 | 3300012852 | Bacteria | 419618 |
| 130 | Ga0160448_101591 | 3300012854 | Bacteria | 7280 |
| 131 | Ga0160435_1000197 | 3300012857 | Bacteria | 29578 |
| 132 | Ga0160457_1000078 | 3300012858 | Bacteria | 141304 |
| 133 | Ga0265387_1000032 | 3300024582 | Bacteria | 53128 |
| 134 | Ga0466657_125351 | 3300042582 | Bacteria | 34179 |
| 135 | Ga0466734_076183 | 3300042623 | Bacteria | 2499 |
| 136 | Ga0466734_098613 | 3300042623 | Bacteria | 8671 |
| 137 | Ga0530661_000349 | 3300056564 | Bacteria | 35531 |
| 138 | Ga0562376_0037 | 3300056857 | Bacteria | 334679 |
| 139 | Ga0123355_10256527 | 3300009826 | Bacteria | 2453 |
| 140 | Ga0123356_10003490 | 3300010049 | Bacteria | 16445 |
| 141 | Ga0123356_10007657 | 3300010049 | Bacteria | 10760 |
| 142 | Ga0123356_10013093 | 3300010049 | Bacteria | 8022 |
| 143 | Ga0160465_100091 | 3300012803 | Bacteria | 96557 |
| 144 | Ga0160442_101147 | 3300012806 | Bacteria | 3403 |
| 145 | Ga0466710_010682 | 3300042613 | Bacteria | 4545 |
| 146 | Ga0466711_297137 | 3300042615 | Bacteria | 4693 |
| 147 | Ga0160467_100496 | 3300012829 | Bacteria | 37884 |
| 148 | Ga0160472_100099 | 3300012839 | Bacteria | 139107 |
| 149 | Ga0160472_100137 | 3300012839 | Bacteria | 109936 |
| 150 | Ga0160460_100089 | 3300012845 | Bacteria | 134464 |
| 151 | Ga0160447_104993 | 3300012849 | Bacteria | 3791 |
| 152 | Ga0160436_1000374 | 3300012861 | Bacteria | 18863 |
| 153 | Ga0466693_179905 | 3300042592 | Bacteria | 56896 |
| 154 | Ga0466696_012795 | 3300042596 | Bacteria | 3170 |
| 155 | Ga0466724_07603 | 3300042649 | Bacteria | 364013 |
| 156 | Ga0466724_19422 | 3300042649 | Bacteria | 39552 |
| 157 | Ga0562379_2288 | 3300056790 | Unclassified | 16447 |
| 158 | Ga0562375_0017 | 3300056856 | Bacteria | 949401 |
| 159 | Ga0562375_1350 | 3300056856 | Bacteria | 34097 |
| 160 | Ga0123356_10005417 | 3300010049 | Bacteria | 12992 |
| 161 | Ga0160471_100224 | 3300012812 | Bacteria | 19617 |
| 162 | Ga0466701_019646 | 3300042598 | Bacteria | 45844 |
| 163 | Ga0466707_127171 | 3300042601 | Bacteria | 10752 |
| 164 | JGI24705J35276_12238715 | 3300002504 | Bacteria | 41934 |
| 165 | Ga0068305_10046451 | 3300005083 | Bacteria | 5040 |
| 166 | Ga0160470_100299 | 3300012813 | Bacteria | 29723 |
| 167 | Ga0160441_100019 | 3300012825 | Bacteria | 282738 |
| 168 | Ga0466734_108602 | 3300042623 | Bacteria | 6015 |
| 169 | Ga0466730_039992 | 3300042625 | Bacteria | 1355215 |
| 170 | Ga0466730_097984 | 3300042625 | Bacteria | 727286 |
| 171 | Ga0466704_461298 | 3300042643 | Bacteria | 7823 |
| 172 | Ga0466724_24570 | 3300042649 | Bacteria | 4160 |
| 173 | Ga0466725_168370 | 3300042654 | Bacteria | 14605 |
| 174 | Ga0123357_10119371 | 3300009784 | Bacteria | 3328 |
| 175 | Ga0123355_10139755 | 3300009826 | Bacteria | 3709 |
| 176 | Ga0123356_10006573 | 3300010049 | Bacteria | 11712 |
| 177 | Ga0123356_10007680 | 3300010049 | Bacteria | 10745 |
| 178 | Ga0123354_10000019 | 3300010882 | Bacteria | 128383 |
| 179 | Ga0466701_098447 | 3300042598 | Bacteria | 82442 |
| 180 | FGTW_contig30670 | 2065487013 | Bacteria | 11835 |
| 181 | JGI24705J35276_12238462 | 3300002504 | Bacteria | 22970 |
| 182 | Ga0466710_020985 | 3300042613 | Bacteria | 6505 |
| 183 | Ga0160467_100953 | 3300012829 | Unclassified | 16509 |
| 184 | Ga0160459_100013 | 3300012831 | Bacteria | 431763 |
| 185 | Ga0160459_100041 | 3300012831 | Bacteria | 228416 |
| 186 | Ga0160472_100161 | 3300012839 | Bacteria | 93574 |
| 187 | Ga0160447_100777 | 3300012849 | Bacteria | 13782 |
| 188 | Ga0160457_1000042 | 3300012858 | Bacteria | 211595 |
| 189 | Ga0160457_1000147 | 3300012858 | Bacteria | 71263 |
| 190 | Ga0160436_1004120 | 3300012861 | Bacteria | 3492 |
| 191 | Ga0466734_018070 | 3300042623 | Bacteria | 12968 |
| 192 | Ga0466734_090437 | 3300042623 | Bacteria | 3493 |
| 193 | Ga0466724_20523 | 3300042649 | Bacteria | 15773 |
| 194 | Ga0466724_69524 | 3300042649 | Bacteria | 891007 |
| 195 | Ga0466725_318339 | 3300042654 | Unclassified | 28808 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00141 | peroxidase | Peroxidase | 115 | 446 | 0.86 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.