Protein Family IF03759

Metagenome Isolate
310 Members
161 Samples
75 Scaffolds
539.05 Avg Length

🧬 Representative Sequence

ID
3300012829|Ga0160467_102682|Ga0160467_1026822
Length
568 aa
Sequence
MPLLRVVLKNRYFRPSRQQRYPEEITAAHILGDSMERTTVKPLLLALALASTTPFAQAATTLVYCSEASPAGFDPSQYTSGTDFDASAETVFNRLTQFKRGGTEIEPGLATSWDVSTDGLTYTFHLRDGVKFHTTDYFTPTRDFNADDVLFTFKRLLDPENAFRKAYPAESPYFTDMGLNTTIKSVDKIDDHTVRFNLNNVDAAFVQNLAMSFASVQSAEYAAQLLKDGKAADLNQKPVGTGPFVFKRYQKDSQIRYTANRSYWKPEDVKLDNLVFSITPDAAVRLQKLKAGECQVSGYPRPADIEVMEKDPNLRVLKQAGFNLGFLAYNVTHPPLDQLKVRQALDMAIDKPAIIKAVYQSAGQLAQNALPPAQWSYDPGIKDAPHDPAKAKALLKEAGVAPGTTINLWAMTVQRASNPNARMSAQMIQQDWEKVGIKANIVSYEWGEYIKRAKNGEHDAMIYGWTGDNGDPDNWLGVLYSCAAVKGSNYAKWCDPAYDKLVQQAKVSTDRQQRINLYQQAQQILKQQVPITPIANSTVFQPLRKEVTDFKISPFGLTPFYGVGINK*

📊 Sample Types

Isolate 68.4%
Metagenome 31.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Coreidae 53.3%
Elmidae 8.7%
Curculionidae 6.7%
Culicidae 6.7%
Armadillidiidae 5.3%
Unclassified 4.7%
Formicidae 4.7%
Termitidae 2.0%
Berytidae 1.3%
Drosophilidae 1.3%
Largidae 1.3%
Tenebrionidae 0.7%
Thripidae 0.7%
Trigoniulidae 0.7%
Rhinotermitidae 0.7%
Alydidae 0.7%
Siricidae 0.7%

🌳 Taxonomy

Archaea 0
Bacteria 278
Eukaryota 0
Viruses 0
Unclassified 32

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2044078006 Dendroctonus frontalis bacterial communities from Mississippi, USA Metagenome Curculionidae
2 2820123897 Unclassified Proteobacteria Emb289P4bin18 Isolate Unclassified
3 2864745180 Pseudomonas rhodesiae S00002 Isolate Elmidae
4 2864847319 Pseudomonas alcaligenes S00099 Isolate Elmidae
5 2864914039 Chromobacterium alkanivorans S00172 Isolate Elmidae
6 2864988360 Chromobacterium alkanivorans S00296 Isolate Elmidae
7 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
8 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
9 3300012831 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG Metagenome Culicidae
10 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
11 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
12 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
13 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
14 8023724303 Caballeronia zhejiangensis LP003 Isolate Coreidae
15 8024001094 Caballeronia sp. TF1N1 Isolate Berytidae
16 8025666332 Caballeronia grimmiae LZ050 Isolate Coreidae
17 8025694439 Caballeronia cordobensis LZ033 Isolate Coreidae
18 8025701579 Caballeronia telluris LZ031 Isolate Coreidae
19 8052469819 Pseudomonas putida DZ-F23 Isolate
20 8101967387 Caballeronia sp. AAUFL_F3_KS11A Isolate Coreidae
21 8102007614 Caballeronia sp. ATUFL_M1_KS5A Isolate Coreidae
22 8102041249 Caballeronia sp. GACF4 Isolate Coreidae
23 8102087471 Caballeronia sp. GAWG2-1 Isolate Coreidae
24 8102201977 Caballeronia sp. LZ031 Isolate Coreidae
25 8102264549 Caballeronia sp. NCF2 Isolate Coreidae
26 2065487013 Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm Metagenome
27 2864739902 Pseudomonas viridiflavia S00001 Isolate Elmidae
28 2864853652 Pseudomonas rhodesiae S00114 Isolate Elmidae
29 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
30 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Formicidae
31 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
32 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
33 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
34 8025716094 Caballeronia zhejiangensis LZ028 Isolate Coreidae
35 8101960468 Caballeronia sp. AAUFL_F2_KS46 Isolate Coreidae
36 8101988189 Caballeronia sp. ATUFL_F1_KS4A Isolate Coreidae
37 8102014801 Caballeronia sp. ATUFL_M2_KS44 Isolate Coreidae
38 8102060671 Caballeronia sp. GAFFF2 Isolate Coreidae
39 8102152052 Caballeronia sp. LZ001 Isolate Coreidae
40 8102208438 Caballeronia sp. LZ032 Isolate Coreidae
41 8102251710 Caballeronia sp. LZ065 Isolate Coreidae
42 8102279326 Caballeronia sp. NCTM1 Isolate Coreidae
43 2032320009 Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine Metagenome Curculionidae
44 2841821538 Psychrobacter sp. YP14 Isolate Unclassified
45 2864903489 Pseudomonas aeuginosa S00161 Isolate Elmidae
46 2871760914 Pantoea ananatis PANS 01-2 Isolate Thripidae
47 3300007130 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut Metagenome Drosophilidae
48 3300012818 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG Metagenome
49 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
50 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
51 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
52 8025650824 Caballeronia hypogeia LZ032 Isolate Coreidae
53 8025671076 Caballeronia cordobensis LZ034LL Isolate Coreidae
54 8025735396 Caballeronia zhejiangensis LZ016 Isolate Coreidae
55 8102047609 Caballeronia sp. GACF5 Isolate Coreidae
56 8102074813 Caballeronia sp. GAWG1-1 Isolate Coreidae
57 8102081745 Caballeronia sp. GAWG1-5s-s Isolate Coreidae
58 8102117041 Caballeronia sp. INML3 Isolate Coreidae
59 8102131453 Caballeronia sp. INML5 Isolate Coreidae
60 8102138357 Caballeronia sp. INSB1 Isolate Coreidae
61 8102216467 Caballeronia sp. LZ033 Isolate Coreidae
62 8102230706 Caballeronia sp. LZ035 Isolate Coreidae
63 8102239244 Caballeronia sp. LZ043 Isolate Coreidae
64 2864751016 Pseudomonas oryzihabitans S00005 Isolate Elmidae
65 2864968865 Paucibacter oligotrophus S00239 Isolate Elmidae
66 2990166910 Pseudomonas typographi CA3A Isolate Curculionidae
67 3007478678 Pseudomonas sp. S37 Isolate Curculionidae
68 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
69 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Drosophilidae
70 3300012798 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG Metagenome
71 3300012803 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG Metagenome
72 3300012815 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG Metagenome
73 3300026175 Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 Metagenome Formicidae
74 637000219 Pseudomonas entomophila L48 Isolate Unclassified
75 8025658853 Caballeronia temeraria LZ065 Isolate Coreidae
76 8025708040 Caballeronia jiangsuensis LZ029 Isolate Coreidae
77 8035326735 Pseudomonas prosekii A2-NA13 Isolate Curculionidae
78 8069770227 Caballeronia sp. LZ019 Isolate Coreidae
79 8101994502 Caballeronia sp. ATUFL_F2_KS42 Isolate Coreidae
80 8102124461 Caballeronia sp. INML3B Isolate Coreidae
81 8102193924 Caballeronia sp. LZ029 Isolate Coreidae
82 8102312426 Caballeronia sp. AAUFL_F1_KS47 Isolate Coreidae
83 2519899622 Pseudomonas sp. Ag1 Isolate Culicidae
84 3003869270 Paraburkholderia sp. PGU16 Isolate Largidae
85 3007473699 Pseudomonas sp. S30 Isolate Curculionidae
86 8011329375 Pseudomonas sp. S31 Isolate Curculionidae
87 8011357093 Pseudomonas schmalbachii Milli4 Isolate Trigoniulidae
88 8023747282 Caballeronia zhejiangensis LZ019 Isolate Coreidae
89 8024025509 Caballeronia grimmiae Lep1A1 Isolate Coreidae
90 8024037630 Caballeronia zhejiangensis A33_M4_a Isolate Coreidae
91 8025685901 Caballeronia fortuita LZ035 Isolate Coreidae
92 8025723035 Caballeronia grimmiae LZ025 Isolate Coreidae
93 8025756023 Caballeronia peredens LZ002 Isolate Coreidae
94 8078130113 Caballeronia sp. INDeC2 Isolate Coreidae
95 8102054868 Caballeronia sp. GAFFF1 Isolate Coreidae
96 8102102351 Caballeronia sp. INML1 Isolate Coreidae
97 8102161003 Caballeronia sp. LZ002 Isolate Coreidae
98 8102174626 Caballeronia sp. LZ024 Isolate Coreidae
99 8102246966 Caballeronia sp. LZ050 Isolate Coreidae
100 2035918003 Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine Metagenome Curculionidae
101 3300002938 Larval gut metagenome for colony PL005 Metagenome Formicidae
102 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
103 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
104 3300012828 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG Metagenome
105 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae
106 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
107 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
108 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
109 8024014383 Caballeronia sp. SL2Y3 Isolate Berytidae
110 8025740903 Caballeronia zhejiangensis LZ008 Isolate Coreidae
111 8069748016 Caballeronia sp. LP003 Isolate Coreidae
112 8102033761 Caballeronia sp. AZ7_KS35 Isolate Coreidae
113 8102094248 Caballeronia sp. GaOx3 Isolate Coreidae
114 8102109360 Caballeronia sp. INML2 Isolate Coreidae
115 8102145433 Caballeronia sp. LP006 Isolate Coreidae
116 8102186987 Caballeronia sp. LZ028 Isolate Coreidae
117 8102223607 Caballeronia sp. LZ034LL Isolate Coreidae
118 8102286609 Caballeronia sp. NCTM5 Isolate Coreidae
119 2571042003 Stenoxybacter acetivorans DSM 19021 Isolate Rhinotermitidae
120 2597489944 Caballeronia insecticola RPE64 Isolate Alydidae
121 2778261153 Escherichia coli MOD1-EC286 Isolate Unclassified
122 2864808494 Chitinimonas taiwanensis S00056 Isolate Elmidae
123 2864926767 Pseudomonas nitritireducens S00179 Isolate Elmidae
124 3003878002 Paraburkholderia sp. PGU19 Isolate Largidae
125 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
126 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
127 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
128 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
129 8023752828 Caballeronia grimmiae LZ062 Isolate Coreidae
130 8024019580 Caballeronia sp. Lep1P3 Isolate Coreidae
131 8024044713 Caballeronia sp. Sq4a Isolate Coreidae
132 8035422605 Pseudomonas monteilii CY06 Isolate
133 8069763219 Caballeronia sp. LZ008 Isolate Coreidae
134 8102001125 Caballeronia sp. ATUFL_F2_KS9A Isolate Coreidae
135 8102169119 Caballeronia sp. LZ016 Isolate Coreidae
136 8102181083 Caballeronia sp. LZ025 Isolate Coreidae
137 8102271933 Caballeronia sp. NCF4 Isolate Coreidae
138 2100351016 Sirex noctilio microbial communities from Pennsylvania, USA - adult community Metagenome Siricidae
139 2864812326 Chitinimonas taiwanensis S00057 Isolate Elmidae
140 2864859030 Chromobacterium alkanivorans S00115 Isolate Elmidae
141 2997878596 Pseudomonas bohemica IA9 Isolate Unclassified
142 3300002464 Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 Metagenome Culicidae
143 3300007224 Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut Metagenome Unclassified
144 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
145 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
146 3300012812 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG Metagenome Culicidae
147 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
148 8023757577 Caballeronia peredens LP006 Isolate Coreidae
149 8023764196 Caballeronia peredens LZ001 Isolate Coreidae
150 8025678175 Caballeronia hypogeia LZ043 Isolate Coreidae
151 8025728939 Caballeronia telluris LZ024 Isolate Coreidae
152 8025747911 Caballeronia peredens LZ003 Isolate Coreidae
153 8035321120 Pseudomonas prosekii A2-NA12 Isolate Curculionidae
154 8069755105 Caballeronia sp. LZ003 Isolate Coreidae
155 8069775773 Caballeronia sp. LZ062 Isolate Coreidae
156 8101951471 Caballeronia sp. AAUFL_F1_KS45 Isolate Coreidae
157 8101974301 Caballeronia sp. ASUFL_F2_KS49 Isolate Coreidae
158 8101981714 Caballeronia sp. ATUFL_F1_KS39 Isolate Coreidae
159 8102020860 Caballeronia sp. AZ10_KS36 Isolate Coreidae
160 8102026984 Caballeronia sp. AZ1_KS37 Isolate Coreidae
161 8102067727 Caballeronia sp. GAFFF3 Isolate Coreidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466701_032540 3300042598 Bacteria 10018
2 Ga0466713_014808 3300042602 Bacteria 349625
3 Ga0160432_100467 3300012818 Bacteria 26343
4 Ga0160469_102555 3300012824 Unclassified 3288
5 Ga0160467_102682 3300012829 Bacteria 3656
6 Meta3P_1001457 3300002464 Unclassified 23408
7 CVPL010W_10009297 3300002931 Bacteria 8972
8 CVPL005W_1000162 3300002934 Bacteria 29037
9 Ga0102734_1003829 3300007129 Bacteria 3399
10 Ga0104147_1020297 3300007224 Bacteria 8430
11 Ga0160466_100249 3300012809 Bacteria 36542
12 Ga0160466_100346 3300012809 Unclassified 27845
13 Ga0466724_47254 3300042649 Bacteria 18795
14 Ga0160467_102301 3300012829 Unclassified 4479
15 Ga0160460_100788 3300012845 Unclassified 14503
16 Ga0160445_100365 3300012847 Bacteria 25559
17 DPO_contig08621 2032320009 Bacteria 19466
18 SWWA_contig16970__length_4489___numreads_75 2100351016 Unclassified 4489
19 Ga0063521_1000044 3300003973 Bacteria 108331
20 Ga0103264_1000198 3300007188 Bacteria 49831
21 Ga0103264_1001398 3300007188 Bacteria 10609
22 Ga0103268_1003474 3300007192 Bacteria 3302
23 Ga0105005_1024496 3300007505 Unclassified 4879
24 Ga0466724_22286 3300042649 Bacteria 91157
25 Ga0466701_026230 3300042598 Bacteria 150849
26 Ga0160440_100220 3300012815 Unclassified 42429
27 Ga0160455_102486 3300012837 Bacteria 3764
28 Ga0160447_102708 3300012849 Unclassified 6051
29 Ga0160436_1007874 3300012861 Unclassified 2417
30 DPOL_contig19706 2035918003 Bacteria 59159
31 Ga0105005_1032673 3300007505 Bacteria 9235
32 Ga0160454_100705 3300012798 Unclassified 7275
33 Ga0160465_100583 3300012803 Bacteria 15678
34 Ga0466701_096949 3300042598 Bacteria 149718
35 Ga0160470_100228 3300012813 Unclassified 44164
36 Ga0160459_101617 3300012831 Unclassified 4573
37 FGTW_contig29636 2065487013 Bacteria 7011
38 CVPL010W_10001139 3300002931 Bacteria 30625
39 Ga0160466_101089 3300012809 Unclassified 8852
40 Ga0562378_0015 3300056814 Bacteria 945537
41 Ga0160441_100788 3300012825 Unclassified 16552
42 Ga0160447_101097 3300012849 Unclassified 11006
43 Ga0160457_1001475 3300012858 Bacteria 6408
44 DPOL_contig06126 2035918003 Bacteria 42797
45 CVPL005L_10001161 3300002938 Bacteria 29805
46 Ga0102734_1010455 3300007129 Bacteria 4282
47 Ga0104042_1001193 3300007130 Bacteria 2336
48 Ga0103264_1000156 3300007188 Bacteria 41202
49 Ga0160444_100779 3300012841 Unclassified 9357
50 Ga0160433_100085 3300012846 Bacteria 96359
51 Ga0160433_102743 3300012846 Bacteria 3565
52 Ga0160447_101587 3300012849 Bacteria 8675
53 Ga0160448_100841 3300012854 Bacteria 10358
54 Ga0160448_105623 3300012854 Bacteria 3254
55 Ga0160436_1009300 3300012861 Unclassified 2177
56 Ga0466701_011800 3300042598 Bacteria 98335
57 DPO_contig00839 2032320009 Unclassified 13277
58 SPBB_contig11539 2044078006 Bacteria 54533
59 CVPL005W_1001282 3300002934 Unclassified 13648
60 Ga0105005_1025589 3300007505 Bacteria 5581
61 Ga0160471_100732 3300012812 Unclassified 8022
62 Ga0466724_33450 3300042649 Bacteria 14449
63 Ga0160431_100483 3300012828 Unclassified 16446
64 Ga0160433_100231 3300012846 Bacteria 40955
65 Ga0160443_101426 3300012848 Unclassified 8124
66 Ga0160430_101164 3300012852 Bacteria 10563
67 SPBB_contig09103 2044078006 Bacteria 56705
68 SWWA_contig13739__length_9942___numreads_562 2100351016 Bacteria 9942
69 CVPL005W_1000080 3300002934 Bacteria 37325
70 Ga0123357_10000050 3300009784 Bacteria 93540
71 Ga0466701_041263 3300042598 Bacteria 158002
72 Ga0160434_101507 3300012850 Unclassified 4327
73 Ga0160448_100023 3300012854 Bacteria 202907
74 Ga0255572_1000006 3300026175 Bacteria 236537
75 SPBB_contig11367 2044078006 Unclassified 3442

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle 104 484 0.97

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.