Protein Family IF03759
Metagenome
Isolate
310
Members
161
Samples
75
Scaffolds
539.05
Avg Length
Representative Sequence
- ID
- 3300012829|Ga0160467_102682|Ga0160467_1026822
- Length
- 568 aa
- Sequence
- MPLLRVVLKNRYFRPSRQQRYPEEITAAHILGDSMERTTVKPLLLALALASTTPFAQAATTLVYCSEASPAGFDPSQYTSGTDFDASAETVFNRLTQFKRGGTEIEPGLATSWDVSTDGLTYTFHLRDGVKFHTTDYFTPTRDFNADDVLFTFKRLLDPENAFRKAYPAESPYFTDMGLNTTIKSVDKIDDHTVRFNLNNVDAAFVQNLAMSFASVQSAEYAAQLLKDGKAADLNQKPVGTGPFVFKRYQKDSQIRYTANRSYWKPEDVKLDNLVFSITPDAAVRLQKLKAGECQVSGYPRPADIEVMEKDPNLRVLKQAGFNLGFLAYNVTHPPLDQLKVRQALDMAIDKPAIIKAVYQSAGQLAQNALPPAQWSYDPGIKDAPHDPAKAKALLKEAGVAPGTTINLWAMTVQRASNPNARMSAQMIQQDWEKVGIKANIVSYEWGEYIKRAKNGEHDAMIYGWTGDNGDPDNWLGVLYSCAAVKGSNYAKWCDPAYDKLVQQAKVSTDRQQRINLYQQAQQILKQQVPITPIANSTVFQPLRKEVTDFKISPFGLTPFYGVGINK*
Sample Types
Isolate
68.4%
Metagenome
31.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Coreidae
53.3%
Elmidae
8.7%
Curculionidae
6.7%
Culicidae
6.7%
Armadillidiidae
5.3%
Unclassified
4.7%
Formicidae
4.7%
Termitidae
2.0%
Berytidae
1.3%
Drosophilidae
1.3%
Largidae
1.3%
Tenebrionidae
0.7%
Thripidae
0.7%
Trigoniulidae
0.7%
Rhinotermitidae
0.7%
Alydidae
0.7%
Siricidae
0.7%
Taxonomy
Archaea
0
Bacteria
278
Eukaryota
0
Viruses
0
Unclassified
32
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2044078006 | Dendroctonus frontalis bacterial communities from Mississippi, USA | Metagenome | Curculionidae |
| 2 | 2820123897 | Unclassified Proteobacteria Emb289P4bin18 | Isolate | Unclassified |
| 3 | 2864745180 | Pseudomonas rhodesiae S00002 | Isolate | Elmidae |
| 4 | 2864847319 | Pseudomonas alcaligenes S00099 | Isolate | Elmidae |
| 5 | 2864914039 | Chromobacterium alkanivorans S00172 | Isolate | Elmidae |
| 6 | 2864988360 | Chromobacterium alkanivorans S00296 | Isolate | Elmidae |
| 7 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 8 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 9 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 10 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 11 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 12 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 13 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 14 | 8023724303 | Caballeronia zhejiangensis LP003 | Isolate | Coreidae |
| 15 | 8024001094 | Caballeronia sp. TF1N1 | Isolate | Berytidae |
| 16 | 8025666332 | Caballeronia grimmiae LZ050 | Isolate | Coreidae |
| 17 | 8025694439 | Caballeronia cordobensis LZ033 | Isolate | Coreidae |
| 18 | 8025701579 | Caballeronia telluris LZ031 | Isolate | Coreidae |
| 19 | 8052469819 | Pseudomonas putida DZ-F23 | Isolate | |
| 20 | 8101967387 | Caballeronia sp. AAUFL_F3_KS11A | Isolate | Coreidae |
| 21 | 8102007614 | Caballeronia sp. ATUFL_M1_KS5A | Isolate | Coreidae |
| 22 | 8102041249 | Caballeronia sp. GACF4 | Isolate | Coreidae |
| 23 | 8102087471 | Caballeronia sp. GAWG2-1 | Isolate | Coreidae |
| 24 | 8102201977 | Caballeronia sp. LZ031 | Isolate | Coreidae |
| 25 | 8102264549 | Caballeronia sp. NCF2 | Isolate | Coreidae |
| 26 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 27 | 2864739902 | Pseudomonas viridiflavia S00001 | Isolate | Elmidae |
| 28 | 2864853652 | Pseudomonas rhodesiae S00114 | Isolate | Elmidae |
| 29 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 30 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 31 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 32 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 33 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 34 | 8025716094 | Caballeronia zhejiangensis LZ028 | Isolate | Coreidae |
| 35 | 8101960468 | Caballeronia sp. AAUFL_F2_KS46 | Isolate | Coreidae |
| 36 | 8101988189 | Caballeronia sp. ATUFL_F1_KS4A | Isolate | Coreidae |
| 37 | 8102014801 | Caballeronia sp. ATUFL_M2_KS44 | Isolate | Coreidae |
| 38 | 8102060671 | Caballeronia sp. GAFFF2 | Isolate | Coreidae |
| 39 | 8102152052 | Caballeronia sp. LZ001 | Isolate | Coreidae |
| 40 | 8102208438 | Caballeronia sp. LZ032 | Isolate | Coreidae |
| 41 | 8102251710 | Caballeronia sp. LZ065 | Isolate | Coreidae |
| 42 | 8102279326 | Caballeronia sp. NCTM1 | Isolate | Coreidae |
| 43 | 2032320009 | Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine | Metagenome | Curculionidae |
| 44 | 2841821538 | Psychrobacter sp. YP14 | Isolate | Unclassified |
| 45 | 2864903489 | Pseudomonas aeuginosa S00161 | Isolate | Elmidae |
| 46 | 2871760914 | Pantoea ananatis PANS 01-2 | Isolate | Thripidae |
| 47 | 3300007130 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut | Metagenome | Drosophilidae |
| 48 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 49 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 50 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 51 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 52 | 8025650824 | Caballeronia hypogeia LZ032 | Isolate | Coreidae |
| 53 | 8025671076 | Caballeronia cordobensis LZ034LL | Isolate | Coreidae |
| 54 | 8025735396 | Caballeronia zhejiangensis LZ016 | Isolate | Coreidae |
| 55 | 8102047609 | Caballeronia sp. GACF5 | Isolate | Coreidae |
| 56 | 8102074813 | Caballeronia sp. GAWG1-1 | Isolate | Coreidae |
| 57 | 8102081745 | Caballeronia sp. GAWG1-5s-s | Isolate | Coreidae |
| 58 | 8102117041 | Caballeronia sp. INML3 | Isolate | Coreidae |
| 59 | 8102131453 | Caballeronia sp. INML5 | Isolate | Coreidae |
| 60 | 8102138357 | Caballeronia sp. INSB1 | Isolate | Coreidae |
| 61 | 8102216467 | Caballeronia sp. LZ033 | Isolate | Coreidae |
| 62 | 8102230706 | Caballeronia sp. LZ035 | Isolate | Coreidae |
| 63 | 8102239244 | Caballeronia sp. LZ043 | Isolate | Coreidae |
| 64 | 2864751016 | Pseudomonas oryzihabitans S00005 | Isolate | Elmidae |
| 65 | 2864968865 | Paucibacter oligotrophus S00239 | Isolate | Elmidae |
| 66 | 2990166910 | Pseudomonas typographi CA3A | Isolate | Curculionidae |
| 67 | 3007478678 | Pseudomonas sp. S37 | Isolate | Curculionidae |
| 68 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 69 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 70 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 71 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 72 | 3300012815 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG | Metagenome | |
| 73 | 3300026175 | Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 | Metagenome | Formicidae |
| 74 | 637000219 | Pseudomonas entomophila L48 | Isolate | Unclassified |
| 75 | 8025658853 | Caballeronia temeraria LZ065 | Isolate | Coreidae |
| 76 | 8025708040 | Caballeronia jiangsuensis LZ029 | Isolate | Coreidae |
| 77 | 8035326735 | Pseudomonas prosekii A2-NA13 | Isolate | Curculionidae |
| 78 | 8069770227 | Caballeronia sp. LZ019 | Isolate | Coreidae |
| 79 | 8101994502 | Caballeronia sp. ATUFL_F2_KS42 | Isolate | Coreidae |
| 80 | 8102124461 | Caballeronia sp. INML3B | Isolate | Coreidae |
| 81 | 8102193924 | Caballeronia sp. LZ029 | Isolate | Coreidae |
| 82 | 8102312426 | Caballeronia sp. AAUFL_F1_KS47 | Isolate | Coreidae |
| 83 | 2519899622 | Pseudomonas sp. Ag1 | Isolate | Culicidae |
| 84 | 3003869270 | Paraburkholderia sp. PGU16 | Isolate | Largidae |
| 85 | 3007473699 | Pseudomonas sp. S30 | Isolate | Curculionidae |
| 86 | 8011329375 | Pseudomonas sp. S31 | Isolate | Curculionidae |
| 87 | 8011357093 | Pseudomonas schmalbachii Milli4 | Isolate | Trigoniulidae |
| 88 | 8023747282 | Caballeronia zhejiangensis LZ019 | Isolate | Coreidae |
| 89 | 8024025509 | Caballeronia grimmiae Lep1A1 | Isolate | Coreidae |
| 90 | 8024037630 | Caballeronia zhejiangensis A33_M4_a | Isolate | Coreidae |
| 91 | 8025685901 | Caballeronia fortuita LZ035 | Isolate | Coreidae |
| 92 | 8025723035 | Caballeronia grimmiae LZ025 | Isolate | Coreidae |
| 93 | 8025756023 | Caballeronia peredens LZ002 | Isolate | Coreidae |
| 94 | 8078130113 | Caballeronia sp. INDeC2 | Isolate | Coreidae |
| 95 | 8102054868 | Caballeronia sp. GAFFF1 | Isolate | Coreidae |
| 96 | 8102102351 | Caballeronia sp. INML1 | Isolate | Coreidae |
| 97 | 8102161003 | Caballeronia sp. LZ002 | Isolate | Coreidae |
| 98 | 8102174626 | Caballeronia sp. LZ024 | Isolate | Coreidae |
| 99 | 8102246966 | Caballeronia sp. LZ050 | Isolate | Coreidae |
| 100 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 101 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 102 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 103 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 104 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 105 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 106 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 107 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 108 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 109 | 8024014383 | Caballeronia sp. SL2Y3 | Isolate | Berytidae |
| 110 | 8025740903 | Caballeronia zhejiangensis LZ008 | Isolate | Coreidae |
| 111 | 8069748016 | Caballeronia sp. LP003 | Isolate | Coreidae |
| 112 | 8102033761 | Caballeronia sp. AZ7_KS35 | Isolate | Coreidae |
| 113 | 8102094248 | Caballeronia sp. GaOx3 | Isolate | Coreidae |
| 114 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 115 | 8102145433 | Caballeronia sp. LP006 | Isolate | Coreidae |
| 116 | 8102186987 | Caballeronia sp. LZ028 | Isolate | Coreidae |
| 117 | 8102223607 | Caballeronia sp. LZ034LL | Isolate | Coreidae |
| 118 | 8102286609 | Caballeronia sp. NCTM5 | Isolate | Coreidae |
| 119 | 2571042003 | Stenoxybacter acetivorans DSM 19021 | Isolate | Rhinotermitidae |
| 120 | 2597489944 | Caballeronia insecticola RPE64 | Isolate | Alydidae |
| 121 | 2778261153 | Escherichia coli MOD1-EC286 | Isolate | Unclassified |
| 122 | 2864808494 | Chitinimonas taiwanensis S00056 | Isolate | Elmidae |
| 123 | 2864926767 | Pseudomonas nitritireducens S00179 | Isolate | Elmidae |
| 124 | 3003878002 | Paraburkholderia sp. PGU19 | Isolate | Largidae |
| 125 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 126 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 127 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 128 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 129 | 8023752828 | Caballeronia grimmiae LZ062 | Isolate | Coreidae |
| 130 | 8024019580 | Caballeronia sp. Lep1P3 | Isolate | Coreidae |
| 131 | 8024044713 | Caballeronia sp. Sq4a | Isolate | Coreidae |
| 132 | 8035422605 | Pseudomonas monteilii CY06 | Isolate | |
| 133 | 8069763219 | Caballeronia sp. LZ008 | Isolate | Coreidae |
| 134 | 8102001125 | Caballeronia sp. ATUFL_F2_KS9A | Isolate | Coreidae |
| 135 | 8102169119 | Caballeronia sp. LZ016 | Isolate | Coreidae |
| 136 | 8102181083 | Caballeronia sp. LZ025 | Isolate | Coreidae |
| 137 | 8102271933 | Caballeronia sp. NCF4 | Isolate | Coreidae |
| 138 | 2100351016 | Sirex noctilio microbial communities from Pennsylvania, USA - adult community | Metagenome | Siricidae |
| 139 | 2864812326 | Chitinimonas taiwanensis S00057 | Isolate | Elmidae |
| 140 | 2864859030 | Chromobacterium alkanivorans S00115 | Isolate | Elmidae |
| 141 | 2997878596 | Pseudomonas bohemica IA9 | Isolate | Unclassified |
| 142 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 143 | 3300007224 | Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut | Metagenome | Unclassified |
| 144 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 145 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 146 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 147 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 148 | 8023757577 | Caballeronia peredens LP006 | Isolate | Coreidae |
| 149 | 8023764196 | Caballeronia peredens LZ001 | Isolate | Coreidae |
| 150 | 8025678175 | Caballeronia hypogeia LZ043 | Isolate | Coreidae |
| 151 | 8025728939 | Caballeronia telluris LZ024 | Isolate | Coreidae |
| 152 | 8025747911 | Caballeronia peredens LZ003 | Isolate | Coreidae |
| 153 | 8035321120 | Pseudomonas prosekii A2-NA12 | Isolate | Curculionidae |
| 154 | 8069755105 | Caballeronia sp. LZ003 | Isolate | Coreidae |
| 155 | 8069775773 | Caballeronia sp. LZ062 | Isolate | Coreidae |
| 156 | 8101951471 | Caballeronia sp. AAUFL_F1_KS45 | Isolate | Coreidae |
| 157 | 8101974301 | Caballeronia sp. ASUFL_F2_KS49 | Isolate | Coreidae |
| 158 | 8101981714 | Caballeronia sp. ATUFL_F1_KS39 | Isolate | Coreidae |
| 159 | 8102020860 | Caballeronia sp. AZ10_KS36 | Isolate | Coreidae |
| 160 | 8102026984 | Caballeronia sp. AZ1_KS37 | Isolate | Coreidae |
| 161 | 8102067727 | Caballeronia sp. GAFFF3 | Isolate | Coreidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466701_032540 | 3300042598 | Bacteria | 10018 |
| 2 | Ga0466713_014808 | 3300042602 | Bacteria | 349625 |
| 3 | Ga0160432_100467 | 3300012818 | Bacteria | 26343 |
| 4 | Ga0160469_102555 | 3300012824 | Unclassified | 3288 |
| 5 | Ga0160467_102682 | 3300012829 | Bacteria | 3656 |
| 6 | Meta3P_1001457 | 3300002464 | Unclassified | 23408 |
| 7 | CVPL010W_10009297 | 3300002931 | Bacteria | 8972 |
| 8 | CVPL005W_1000162 | 3300002934 | Bacteria | 29037 |
| 9 | Ga0102734_1003829 | 3300007129 | Bacteria | 3399 |
| 10 | Ga0104147_1020297 | 3300007224 | Bacteria | 8430 |
| 11 | Ga0160466_100249 | 3300012809 | Bacteria | 36542 |
| 12 | Ga0160466_100346 | 3300012809 | Unclassified | 27845 |
| 13 | Ga0466724_47254 | 3300042649 | Bacteria | 18795 |
| 14 | Ga0160467_102301 | 3300012829 | Unclassified | 4479 |
| 15 | Ga0160460_100788 | 3300012845 | Unclassified | 14503 |
| 16 | Ga0160445_100365 | 3300012847 | Bacteria | 25559 |
| 17 | DPO_contig08621 | 2032320009 | Bacteria | 19466 |
| 18 | SWWA_contig16970__length_4489___numreads_75 | 2100351016 | Unclassified | 4489 |
| 19 | Ga0063521_1000044 | 3300003973 | Bacteria | 108331 |
| 20 | Ga0103264_1000198 | 3300007188 | Bacteria | 49831 |
| 21 | Ga0103264_1001398 | 3300007188 | Bacteria | 10609 |
| 22 | Ga0103268_1003474 | 3300007192 | Bacteria | 3302 |
| 23 | Ga0105005_1024496 | 3300007505 | Unclassified | 4879 |
| 24 | Ga0466724_22286 | 3300042649 | Bacteria | 91157 |
| 25 | Ga0466701_026230 | 3300042598 | Bacteria | 150849 |
| 26 | Ga0160440_100220 | 3300012815 | Unclassified | 42429 |
| 27 | Ga0160455_102486 | 3300012837 | Bacteria | 3764 |
| 28 | Ga0160447_102708 | 3300012849 | Unclassified | 6051 |
| 29 | Ga0160436_1007874 | 3300012861 | Unclassified | 2417 |
| 30 | DPOL_contig19706 | 2035918003 | Bacteria | 59159 |
| 31 | Ga0105005_1032673 | 3300007505 | Bacteria | 9235 |
| 32 | Ga0160454_100705 | 3300012798 | Unclassified | 7275 |
| 33 | Ga0160465_100583 | 3300012803 | Bacteria | 15678 |
| 34 | Ga0466701_096949 | 3300042598 | Bacteria | 149718 |
| 35 | Ga0160470_100228 | 3300012813 | Unclassified | 44164 |
| 36 | Ga0160459_101617 | 3300012831 | Unclassified | 4573 |
| 37 | FGTW_contig29636 | 2065487013 | Bacteria | 7011 |
| 38 | CVPL010W_10001139 | 3300002931 | Bacteria | 30625 |
| 39 | Ga0160466_101089 | 3300012809 | Unclassified | 8852 |
| 40 | Ga0562378_0015 | 3300056814 | Bacteria | 945537 |
| 41 | Ga0160441_100788 | 3300012825 | Unclassified | 16552 |
| 42 | Ga0160447_101097 | 3300012849 | Unclassified | 11006 |
| 43 | Ga0160457_1001475 | 3300012858 | Bacteria | 6408 |
| 44 | DPOL_contig06126 | 2035918003 | Bacteria | 42797 |
| 45 | CVPL005L_10001161 | 3300002938 | Bacteria | 29805 |
| 46 | Ga0102734_1010455 | 3300007129 | Bacteria | 4282 |
| 47 | Ga0104042_1001193 | 3300007130 | Bacteria | 2336 |
| 48 | Ga0103264_1000156 | 3300007188 | Bacteria | 41202 |
| 49 | Ga0160444_100779 | 3300012841 | Unclassified | 9357 |
| 50 | Ga0160433_100085 | 3300012846 | Bacteria | 96359 |
| 51 | Ga0160433_102743 | 3300012846 | Bacteria | 3565 |
| 52 | Ga0160447_101587 | 3300012849 | Bacteria | 8675 |
| 53 | Ga0160448_100841 | 3300012854 | Bacteria | 10358 |
| 54 | Ga0160448_105623 | 3300012854 | Bacteria | 3254 |
| 55 | Ga0160436_1009300 | 3300012861 | Unclassified | 2177 |
| 56 | Ga0466701_011800 | 3300042598 | Bacteria | 98335 |
| 57 | DPO_contig00839 | 2032320009 | Unclassified | 13277 |
| 58 | SPBB_contig11539 | 2044078006 | Bacteria | 54533 |
| 59 | CVPL005W_1001282 | 3300002934 | Unclassified | 13648 |
| 60 | Ga0105005_1025589 | 3300007505 | Bacteria | 5581 |
| 61 | Ga0160471_100732 | 3300012812 | Unclassified | 8022 |
| 62 | Ga0466724_33450 | 3300042649 | Bacteria | 14449 |
| 63 | Ga0160431_100483 | 3300012828 | Unclassified | 16446 |
| 64 | Ga0160433_100231 | 3300012846 | Bacteria | 40955 |
| 65 | Ga0160443_101426 | 3300012848 | Unclassified | 8124 |
| 66 | Ga0160430_101164 | 3300012852 | Bacteria | 10563 |
| 67 | SPBB_contig09103 | 2044078006 | Bacteria | 56705 |
| 68 | SWWA_contig13739__length_9942___numreads_562 | 2100351016 | Bacteria | 9942 |
| 69 | CVPL005W_1000080 | 3300002934 | Bacteria | 37325 |
| 70 | Ga0123357_10000050 | 3300009784 | Bacteria | 93540 |
| 71 | Ga0466701_041263 | 3300042598 | Bacteria | 158002 |
| 72 | Ga0160434_101507 | 3300012850 | Unclassified | 4327 |
| 73 | Ga0160448_100023 | 3300012854 | Bacteria | 202907 |
| 74 | Ga0255572_1000006 | 3300026175 | Bacteria | 236537 |
| 75 | SPBB_contig11367 | 2044078006 | Unclassified | 3442 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00496 | SBP_bac_5 | Bacterial extracellular solute-binding proteins, family 5 Middle | 104 | 484 | 0.97 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.