Protein Family IF03728

Metagenome Isolate
179 Members
104 Samples
143 Scaffolds
315.85 Avg Length

🧬 Representative Sequence

ID
3300012825|Ga0160441_100448|Ga0160441_10044827
Length
359 aa
Sequence
MVFWIKGLFRELLTIFCLKNSSKYYGALLSFLPHFFTFAQSLKIMQEKIVVLGSNGQIGTELVTMLRKIYGDDHVVACDIRRPDYDIKNSAPFEFVNVLDKEMIKGIFQKYKPTQVYLLAALLSATGEQNPKLAWDLNMNGLLNVLDLALEYKTAKVYWPSSIAVYGPNSPKDHTAQYCIMDPNTVYGISKLAGERWCEYYHQKYGLDVRSIRYPGLISWKAAPGGGTTDYAIHIFHEALKKGSYQSFLNAETELPMMYMDDAIRGTIELMDAPANQISVRSSYNFAGVSFTPEVLAAEIRKHIPNFTLSYTNNDPRQQIANSWPRSIDDQYAAKDWGWKPEFDLSKLTIDMLNNLKK*

πŸ“Š Sample Types

Isolate 20.1%
Metagenome 79.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 24.5%
Kalotermitidae 12.8%
Culicidae 9.6%
Formicidae 8.5%
Elmidae 7.4%
Unclassified 7.4%
Blattidae 6.4%
Armadillidiidae 4.3%
Rhinotermitidae 4.3%
Drosophilidae 3.2%
Termopsidae 3.2%
Passalidae 2.1%
Hydrophilidae 1.1%
Daphniidae 1.1%
Nephropidae 1.1%
Cambaridae 1.1%
Bombycidae 1.1%
Hodotermitidae 1.1%

🌳 Taxonomy

Archaea 0
Bacteria 169
Eukaryota 0
Viruses 0
Unclassified 10

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2864948220 Elizabethkingia anophelis S00205 Isolate Elmidae
2 2873776654 Pedobacter sp. HDW13 Isolate Hydrophilidae
3 2590828803 Pedobacter glucosidilyticus DD6b Isolate Daphniidae
4 2695420314 Dysgonomonas sp. BGC7 Isolate Unclassified
5 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
6 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
7 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
8 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
9 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
10 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
11 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
12 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
13 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
14 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
15 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
16 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
17 2864923010 Elizabethkingia anophelis S00177 Isolate Elmidae
18 2896321640 Sphingobacterium sp. xlx-130 Isolate
19 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
20 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
21 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
22 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
23 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
24 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
25 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
26 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
27 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
28 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
29 2838772460 Aquimarina sp. I32.4 Isolate Nephropidae
30 2896350215 Sphingobacterium sp. xlx-183 Isolate
31 2910926975 Dysgonomonas sp. 25 Isolate Blattidae
32 2998907766 Penaeicola halotolerans LMIT005 Isolate
33 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
34 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
35 3300007150 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut Metagenome Drosophilidae
36 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
37 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
38 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
39 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
40 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
41 2864755708 Massilia timonae S00006 Isolate Elmidae
42 2898741527 Sphingobacterium sp. xlx-73 Isolate
43 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
44 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
45 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
46 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
47 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
48 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
49 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
50 8020009074 Elizabethkingia anophelis MSU001 Isolate Culicidae
51 2921902974 Chryseobacterium sp. cx-624 Isolate Cambaridae
52 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
53 2579779088 Sphingobacterium paucimobilis HER1398 Isolate Bombycidae
54 2820737921 Unclassified Bacteroidetes Th196P4bin18 Isolate Unclassified
55 3300007068 Ant gut microbial communities from Cephalotes simillimus, Peru Metagenome Formicidae
56 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
57 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
58 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
59 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
60 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
61 2847090942 Elizabethkingia anophelis Ag1 Isolate Culicidae
62 2864882932 Chryseobacterium shingense S00136 Isolate Elmidae
63 2864891731 Chryseobacterium defluvii S00151 Isolate Elmidae
64 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
65 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
66 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
67 3300012828 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG Metagenome
68 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
69 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
70 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
71 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
72 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
73 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
74 2820762746 Unclassified Bacteroidetes Mp193P4bin3 Isolate Unclassified
75 2896330536 Sphingobacterium sp. xlx-96 Isolate
76 2940216256 Dysgonomonadaceae bacterium PH5-43 Isolate Blattidae
77 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
78 2529292732 Elizabethkingia anophelis R26 Isolate Culicidae
79 2718218155 Flavobacteriaceae bacterium UJ101 Isolate
80 3300002464 Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 Metagenome Culicidae
81 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
82 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
83 8114076984 Elizabethkingia anophelis R26 Isolate Culicidae
84 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
85 2864788197 Elizabethkingia anophelis S00027 Isolate Elmidae
86 2864822740 Chryseobacterium shigense S00064 Isolate Elmidae
87 2882250448 Bizionia sp. APA-3 Isolate
88 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
89 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
90 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
91 3300007153 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut Metagenome Drosophilidae
92 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
93 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
94 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
95 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
96 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
97 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
98 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
99 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
100 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
101 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
102 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
103 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
104 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0103265_1000012 3300007068 Bacteria 38095
2 Ga0102734_1000053 3300007129 Bacteria 36803
3 Ga0103264_1000036 3300007188 Bacteria 135516
4 Ga0103267_1000082 3300007190 Bacteria 35603
5 Ga0123353_10045571 3300010167 Bacteria 6960
6 Ga0466707_225904 3300042601 Bacteria 4001
7 Ga0466713_118645 3300042602 Bacteria 113373
8 Ga0466717_022483 3300042604 Bacteria 9356
9 Ga0160472_100810 3300012839 Bacteria 13099
10 Ga0466692_071759 3300042591 Bacteria 6280
11 Ga0466696_133548 3300042596 Bacteria 2961
12 Ga0466703_076072 3300042636 Bacteria 10705
13 Ga0466703_199465 3300042636 Bacteria 1212
14 Ga0466704_181687 3300042643 Bacteria 5578
15 Ga0466710_264903 3300042613 Bacteria 1404
16 Ga0466711_161125 3300042615 Bacteria 26115
17 Ga0466723_086470 3300042618 Bacteria 6757
18 Ga0466726_219540 3300042619 Bacteria 2733
19 Ga0466726_340566 3300042619 Bacteria 5207
20 JGI24699J35502_11019501 3300002509 Bacteria 1443
21 Ga0102736_1000068 3300007052 Bacteria 53396
22 Ga0103267_1000896 3300007190 Bacteria 26851
23 Ga0123355_10351469 3300009826 Bacteria 1952
24 Ga0123356_10404062 3300010049 Bacteria 1504
25 Ga0123354_10070133 3300010882 Bacteria 5073
26 Ga0123354_10169762 3300010882 Bacteria 2545
27 Ga0466706_060088 3300042599 Bacteria 78068
28 Ga0466706_237176 3300042599 Bacteria 4334
29 Ga0160460_100125 3300012845 Bacteria 96320
30 Ga0160433_100134 3300012846 Bacteria 65998
31 Ga0160435_1000005 3300012857 Bacteria 359635
32 Ga0466690_158332 3300042590 Bacteria 8518
33 Ga0466692_119633 3300042591 Bacteria 108688
34 Ga0466692_177796 3300042591 Unclassified 1925
35 Ga0466692_199099 3300042591 Bacteria 25136
36 Ga0466735_069913 3300042624 Bacteria 19536
37 Ga0466704_253255 3300042643 Bacteria 6841
38 Ga0466704_271700 3300042643 Bacteria 14807
39 Ga0466704_430109 3300042643 Bacteria 3747
40 Ga0466709_125926 3300042648 Bacteria 10383
41 Ga0466724_57866 3300042649 Bacteria 279776
42 Ga0466697_218109 3300042611 Unclassified 1229
43 Ga0466705_079333 3300042612 Bacteria 5684
44 Ga0466733_025248 3300042659 Bacteria 4935
45 Ga0103268_1000377 3300007192 Bacteria 14115
46 Ga0123354_10024143 3300010882 Bacteria 9592
47 Ga0466700_033238 3300042600 Bacteria 8542
48 Ga0466700_368547 3300042600 Bacteria 21852
49 Ga0160472_100182 3300012839 Bacteria 83517
50 Ga0466696_045548 3300042596 Bacteria 4336
51 Ga0466729_223727 3300042621 Bacteria 1269
52 Ga0466704_066309 3300042643 Bacteria 57112
53 Ga0466705_514413 3300042612 Bacteria 6780
54 Ga0466710_250458 3300042613 Unclassified 1472
55 Ga0466715_459271 3300042616 Bacteria 28994
56 Ga0466723_143458 3300042618 Bacteria 13107
57 Ga0466705_378642 3300042612 Bacteria 2561
58 2227588808 2225789004 Unclassified 2440
59 IMNBL1DRAFT_c0002679 3300000062 Bacteria 12170
60 IMNBL1DRAFT_c0003960 3300000062 Bacteria 9152
61 IMNBL1DRAFT_c0007894 3300000062 Bacteria 5509
62 JGI24702J35022_10002816 3300002462 Bacteria 10546
63 Ga0104050_1026557 3300007153 Bacteria 4552
64 Ga0103267_1000018 3300007190 Bacteria 59730
65 Ga0123357_10292150 3300009784 Bacteria 1663
66 Ga0466701_057237 3300042598 Bacteria 162355
67 Ga0466722_098653 3300042609 Bacteria 2248
68 Ga0466722_208875 3300042609 Bacteria 6151
69 Ga0160468_100090 3300012819 Bacteria 107635
70 Ga0160469_100013 3300012824 Bacteria 444998
71 Ga0160441_100448 3300012825 Bacteria 31752
72 Ga0466696_249500 3300042596 Bacteria 3048
73 Ga0466729_306992 3300042621 Bacteria 3102
74 Ga0466704_008789 3300042643 Unclassified 1573
75 Ga0466709_176307 3300042648 Bacteria 46103
76 Ga0466709_183787 3300042648 Bacteria 7491
77 Ga0466708_060465 3300042652 Bacteria 14716
78 Ga0466727_151884 3300042655 Bacteria 54336
79 Ga0466727_220242 3300042655 Bacteria 12428
80 Ga0466710_002878 3300042613 Bacteria 1723
81 Ga0466726_289978 3300042619 Bacteria 4336
82 Ga0466697_228209 3300042611 Bacteria 2018
83 JGI24699J35502_11134211 3300002509 Bacteria 60442
84 Ga0102735_1002817 3300007080 Bacteria 2539
85 Ga0104019_1004915 3300007150 Bacteria 2295
86 Ga0123356_10130297 3300010049 Bacteria 2463
87 Ga0123353_10142060 3300010167 Bacteria 3844
88 Ga0123353_10798597 3300010167 Bacteria 1303
89 Ga0123354_10239642 3300010882 Unclassified 1870
90 Ga0466701_018147 3300042598 Bacteria 2396
91 Ga0160455_100062 3300012837 Bacteria 204480
92 Ga0160448_100980 3300012854 Bacteria 9565
93 Ga0466690_091597 3300042590 Unclassified 5618
94 Ga0466692_041100 3300042591 Bacteria 2074
95 Ga0466735_068011 3300042624 Bacteria 2549
96 Ga0466704_195121 3300042643 Bacteria 2846
97 Ga0466715_320776 3300042616 Bacteria 30358
98 JGI24702J35022_10046358 3300002462 Bacteria 2315
99 CVPL010W_10000328 3300002931 Bacteria 47517
100 Ga0068305_10027953 3300005083 Bacteria 12892
101 Ga0123353_10318879 3300010167 Bacteria 2360
102 Ga0123354_10087768 3300010882 Bacteria 4333
103 Ga0466714_098535 3300042603 Bacteria 2394
104 Ga0466716_291553 3300042605 Bacteria 12268
105 Ga0160472_100044 3300012839 Bacteria 224512
106 Ga0466692_003914 3300042591 Bacteria 8447
107 Ga0466693_333363 3300042592 Unclassified 2621
108 Ga0466691_003826 3300042593 Unclassified 12918
109 Ga0466725_412714 3300042654 Bacteria 41724
110 Ga0466711_269359 3300042615 Bacteria 2724
111 Ga0466729_130433 3300042621 Bacteria 3269
112 Meta3P_1000731 3300002464 Bacteria 51610
113 JGI24705J35276_12233391 3300002504 Bacteria 4819
114 Ga0104045_1080302 3300007085 Bacteria 1211
115 Ga0123357_10026192 3300009784 Bacteria 7875
116 Ga0160464_100278 3300012805 Bacteria 47140
117 Ga0466700_288800 3300042600 Unclassified 2213
118 Ga0466713_091714 3300042602 Bacteria 189911
119 Ga0466721_160541 3300042608 Bacteria 27628
120 Ga0160431_102402 3300012828 Bacteria 4415
121 Ga0466694_239402 3300042594 Bacteria 2013
122 Ga0466695_172732 3300042595 Bacteria 2692
123 Ga0466734_010773 3300042623 Bacteria 1287
124 Ga0466735_164752 3300042624 Bacteria 5074
125 Ga0466724_25433 3300042649 Bacteria 649431
126 Ga0466708_087448 3300042652 Bacteria 7594
127 Ga0466708_117301 3300042652 Bacteria 8786
128 Ga0466726_158935 3300042619 Bacteria 13251
129 Ga0466726_177477 3300042619 Bacteria 11122
130 Ga0466705_187464 3300042612 Bacteria 12286
131 JGI24702J35022_10000324 3300002462 Bacteria 28237
132 Ga0104050_1003667 3300007153 Bacteria 3755
133 Ga0103267_1001441 3300007190 Bacteria 5933
134 Ga0123353_10833082 3300010167 Bacteria 1268
135 Ga0123354_10036383 3300010882 Bacteria 7679
136 Ga0466713_136787 3300042602 Bacteria 13136
137 Ga0466696_500008 3300042596 Bacteria 1994
138 Ga0466735_223067 3300042624 Bacteria 4536
139 Ga0466730_092352 3300042625 Bacteria 3883
140 Ga0466709_017802 3300042648 Bacteria 72752
141 Ga0466727_322713 3300042655 Bacteria 1362
142 Ga0466705_502823 3300042612 Bacteria 2068
143 Ga0466711_445451 3300042615 Bacteria 12972

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300010167 Ga0123353_10833082 Ga0123353_108330822 282
2 3300042623 Ga0466734_010773 Ga0466734_010773_222_1178 289
3 3300010882 Ga0123354_10239642 Ga0123354_102396422 292
4 3300009826 Ga0123355_10351469 Ga0123355_103514692 294
5 3300010882 Ga0123354_10070133 Ga0123354_100701335 295
6 3300042613 Ga0466710_002878 Ga0466710_002878_166_1116 295
7 3300042643 Ga0466704_008789 Ga0466704_008789_579_1529 295
8 3300042602 Ga0466713_136787 Ga0466713_136787_633_1583 297
9 3300042619 Ga0466726_219540 Ga0466726_219540_837_1793 297
10 3300042648 Ga0466709_183787 Ga0466709_183787_2910_3863 297
11 3300002462 JGI24702J35022_10046358 JGI24702J35022_100463581 298
12 3300042590 Ga0466690_091597 Ga0466690_091597_3955_4905 298
13 3300042615 Ga0466711_445451 Ga0466711_445451_3815_4765 298
14 3300042643 Ga0466704_066309 Ga0466704_066309_38654_39625 298
15 3300042612 Ga0466705_187464 Ga0466705_187464_4309_5262 299
16 3300042618 Ga0466723_086470 Ga0466723_086470_458_1357 299
17 3300042618 Ga0466723_143458 Ga0466723_143458_2437_3387 299
18 3300042619 Ga0466726_340566 Ga0466726_340566_3516_4457 299
19 3300042636 Ga0466703_199465 Ga0466703_199465_44_943 299
20 3300042655 Ga0466727_220242 Ga0466727_220242_9843_10742 299
21 3300042612 Ga0466705_378642 Ga0466705_378642_1337_2308 300
22 3300042613 Ga0466710_250458 Ga0466710_250458_187_1143 301
23 3300010049 Ga0123356_10404062 Ga0123356_104040622 302
24 3300042655 Ga0466727_322713 Ga0466727_322713_222_1175 304
25 3300042619 Ga0466726_289978 Ga0466726_289978_1560_2513 305
26 3300042648 Ga0466709_017802 Ga0466709_017802_32334_33284 306
27 3300042643 Ga0466704_181687 Ga0466704_181687_442_1398 307
28 3300010167 Ga0123353_10798597 Ga0123353_107985972 310
29 3300010882 Ga0123354_10036383 Ga0123354_100363832 311
30 3300042592 Ga0466693_333363 Ga0466693_333363_1675_2610 311
31 3300007080 Ga0102735_1002817 Ga0102735_10028173 314
32 3300012839 Ga0160472_100044 Ga0160472_100044150 314
33 3300042643 Ga0466704_195121 Ga0466704_195121_1029_1973 314
34 3300042652 Ga0466708_117301 Ga0466708_117301_144_1088 314
35 iso_pr_bacteria 2873776654 2873777541 314
36 2225789004 2227588808 2228145968 315
37 3300002931 CVPL010W_10000328 CVPL010W_1000032820 315
38 3300007190 Ga0103267_1000896 Ga0103267_100089618 315
39 3300010049 Ga0123356_10130297 Ga0123356_101302972 315
40 3300010167 Ga0123353_10318879 Ga0123353_103188792 315
41 3300010882 Ga0123354_10024143 Ga0123354_1002414310 315
42 3300010882 Ga0123354_10087768 Ga0123354_100877682 315
43 3300012824 Ga0160469_100013 Ga0160469_10001358 315
44 3300012828 Ga0160431_102402 Ga0160431_1024023 315
45 3300012839 Ga0160472_100810 Ga0160472_1008102 315
46 3300012857 Ga0160435_1000005 Ga0160435_1000005274 315
47 3300042594 Ga0466694_239402 Ga0466694_239402_406_1353 315
48 3300042599 Ga0466706_060088 Ga0466706_060088_54667_55614 315
49 3300042621 Ga0466729_223727 Ga0466729_223727_205_1152 315
50 3300042621 Ga0466729_306992 Ga0466729_306992_1054_2001 315
51 3300042636 Ga0466703_076072 Ga0466703_076072_7689_8636 315
52 3300042648 Ga0466709_176307 Ga0466709_176307_27558_28505 315
53 3300042652 Ga0466708_087448 Ga0466708_087448_4873_5820 315
54 iso_pr_bacteria 2590828803 2592928634 315
55 iso_pr_bacteria 2820737921 2820737940 315
56 iso_pr_bacteria 2940216256 2940216859 315
57 iso_pr_bacteria 8100166142 8100169357 315
58 3300000062 IMNBL1DRAFT_c0003960 IMNBL1DRAFT_00039602 316
59 3300002462 JGI24702J35022_10000324 JGI24702J35022_1000032419 316
60 3300007068 Ga0103265_1000012 Ga0103265_10000126 316
61 3300007150 Ga0104019_1004915 Ga0104019_10049153 316
62 3300007153 Ga0104050_1026557 Ga0104050_10265573 316
63 3300012805 Ga0160464_100278 Ga0160464_10027841 316
64 3300012845 Ga0160460_100125 Ga0160460_10012536 316
65 3300042590 Ga0466690_158332 Ga0466690_158332_2523_3473 316
66 3300042591 Ga0466692_199099 Ga0466692_199099_17133_18083 316
67 3300042593 Ga0466691_003826 Ga0466691_003826_11172_12122 316
68 3300042596 Ga0466696_045548 Ga0466696_045548_3020_3970 316
69 3300042596 Ga0466696_249500 Ga0466696_249500_1395_2345 316
70 3300042598 Ga0466701_018147 Ga0466701_018147_26_976 316
71 3300042601 Ga0466707_225904 Ga0466707_225904_2367_3317 316
72 3300042605 Ga0466716_291553 Ga0466716_291553_8438_9388 316
73 3300042609 Ga0466722_098653 Ga0466722_098653_756_1706 316
74 3300042612 Ga0466705_502823 Ga0466705_502823_806_1756 316
75 3300042612 Ga0466705_514413 Ga0466705_514413_1265_2215 316
76 3300042613 Ga0466710_264903 Ga0466710_264903_228_1178 316
77 3300042616 Ga0466715_320776 Ga0466715_320776_14611_15561 316
78 3300042619 Ga0466726_177477 Ga0466726_177477_4352_5302 316
79 3300042621 Ga0466729_130433 Ga0466729_130433_856_1806 316
80 3300042624 Ga0466735_068011 Ga0466735_068011_1123_2073 316
81 3300042624 Ga0466735_164752 Ga0466735_164752_3478_4428 316
82 3300042624 Ga0466735_223067 Ga0466735_223067_2941_3891 316
83 3300042643 Ga0466704_271700 Ga0466704_271700_7762_8712 316
84 3300042643 Ga0466704_430109 Ga0466704_430109_1639_2589 316
85 3300042655 Ga0466727_151884 Ga0466727_151884_11894_12844 316
86 iso_pr_bacteria 2579779088 2582237415 316
87 iso_pr_bacteria 2579779088 2582239976 316
88 iso_pr_bacteria 2896321640 2896324871 316
89 iso_pr_bacteria 2896330536 2896333318 316
90 iso_pr_bacteria 2896350215 2896353353 316
91 iso_pr_bacteria 2898741527 2898744456 316
92 3300000062 IMNBL1DRAFT_c0007894 IMNBL1DRAFT_00078942 317
93 3300005083 Ga0068305_10027953 Ga0068305_100279533 317
94 3300007129 Ga0102734_1000053 Ga0102734_100005325 317
95 3300007153 Ga0104050_1003667 Ga0104050_10036673 317
96 3300042591 Ga0466692_119633 Ga0466692_119633_80246_81199 317
97 3300042596 Ga0466696_500008 Ga0466696_500008_760_1713 317
98 3300042611 Ga0466697_228209 Ga0466697_228209_512_1465 317
99 3300042619 Ga0466726_158935 Ga0466726_158935_222_1175 317
100 3300042643 Ga0466704_253255 Ga0466704_253255_2068_3021 317
101 3300042648 Ga0466709_125926 Ga0466709_125926_9128_10081 317
102 iso_pr_bacteria 2882250448 2882250638 317
103 iso_pr_bacteria 2998907766 2998908102 317
104 3300007190 Ga0103267_1000018 Ga0103267_100001810 318
105 3300007190 Ga0103267_1000082 Ga0103267_100008217 318
106 3300007192 Ga0103268_1000377 Ga0103268_10003777 318
107 3300010167 Ga0123353_10045571 Ga0123353_100455715 318
108 3300010882 Ga0123354_10169762 Ga0123354_101697622 318
109 3300012846 Ga0160433_100134 Ga0160433_10013439 318
110 3300042595 Ga0466695_172732 Ga0466695_172732_1214_2170 318
111 3300042600 Ga0466700_368547 Ga0466700_368547_12944_13900 318
112 3300042609 Ga0466722_208875 Ga0466722_208875_1608_2564 318
113 iso_pr_bacteria 2695420314 2695472087 318
114 iso_pr_bacteria 2820759988 2820761509 318
115 3300000062 IMNBL1DRAFT_c0002679 IMNBL1DRAFT_00026798 319
116 3300002509 JGI24699J35502_11019501 JGI24699J35502_110195012 319
117 3300009784 Ga0123357_10026192 Ga0123357_100261922 319
118 3300042591 Ga0466692_041100 Ga0466692_041100_167_1126 319
119 3300042599 Ga0466706_237176 Ga0466706_237176_1252_2211 319
120 3300042600 Ga0466700_033238 Ga0466700_033238_897_1856 319
121 3300042602 Ga0466713_091714 Ga0466713_091714_141662_142621 319
122 3300042604 Ga0466717_022483 Ga0466717_022483_3257_4216 319
123 3300042615 Ga0466711_161125 Ga0466711_161125_4486_5445 319
124 3300042616 Ga0466715_459271 Ga0466715_459271_7304_8263 319
125 3300042659 Ga0466733_025248 Ga0466733_025248_341_1300 319
126 iso_pr_bacteria 2910926975 2910927989 319
127 iso_pr_bacteria 2940244548 2940245200 319
128 iso_pr_bacteria 2940248789 2940249440 319
129 iso_pr_bacteria 2940253009 2940253550 319
130 iso_pr_bacteria 2940257232 2940257405 319
131 iso_pr_bacteria 8100166142 8100166257 319
132 3300009784 Ga0123357_10292150 Ga0123357_102921502 320
133 3300042602 Ga0466713_118645 Ga0466713_118645_3359_4321 320
134 3300042603 Ga0466714_098535 Ga0466714_098535_139_1101 320
135 3300042615 Ga0466711_269359 Ga0466711_269359_1029_1991 320
136 3300042624 Ga0466735_069913 Ga0466735_069913_17728_18690 320
137 3300042625 Ga0466730_092352 Ga0466730_092352_99_1061 320
138 iso_pr_bacteria 2718218155 2720329983 320
139 iso_pr_bacteria 2820762746 2820764971 320
140 iso_pr_bacteria 2864755708 2864757028 320
141 iso_pr_bacteria 2864891731 2864892125 320
142 iso_pr_bacteria 2921902974 2921903670 320
143 3300002509 JGI24699J35502_11134211 JGI24699J35502_1113421127 321
144 3300007052 Ga0102736_1000068 Ga0102736_100006823 321
145 3300007188 Ga0103264_1000036 Ga0103264_100003682 321
146 3300007190 Ga0103267_1001441 Ga0103267_10014417 321
147 3300042591 Ga0466692_071759 Ga0466692_071759_2832_3797 321
148 3300042598 Ga0466701_057237 Ga0466701_057237_10907_11872 321
149 3300042649 Ga0466724_57866 Ga0466724_57866_16765_17730 321
150 3300042654 Ga0466725_412714 Ga0466725_412714_10906_11871 321
151 iso_pr_bacteria 2864822740 2864824225 321
152 iso_pr_bacteria 2864882932 2864883456 321
153 3300002462 JGI24702J35022_10002816 JGI24702J35022_100028163 322
154 3300002504 JGI24705J35276_12233391 JGI24705J35276_122333912 322
155 3300007085 Ga0104045_1080302 Ga0104045_10803021 322
156 3300042649 Ga0466724_25433 Ga0466724_25433_576942_577910 322
157 iso_pr_bacteria 2529292732 2529760785 322
158 iso_pr_bacteria 2847090942 2847094726 322
159 iso_pr_bacteria 2864788197 2864790096 322
160 iso_pr_bacteria 2864923010 2864924909 322
161 iso_pr_bacteria 2864948220 2864949272 322
162 iso_pr_bacteria 8020009074 8020009538 322
163 iso_pr_bacteria 8114076984 8114077193 322
164 3300002464 Meta3P_1000731 Meta3P_100073128 323
165 iso_pr_bacteria 2838772460 2838773837 324
166 3300012819 Ga0160468_100090 Ga0160468_10009027 325
167 3300042596 Ga0466696_133548 Ga0466696_133548_571_1551 326
168 3300042591 Ga0466692_003914 Ga0466692_003914_217_1200 327
169 3300042612 Ga0466705_079333 Ga0466705_079333_3811_4848 327
170 3300012837 Ga0160455_100062 Ga0160455_100062156 329
171 3300012839 Ga0160472_100182 Ga0160472_10018255 329
172 3300042611 Ga0466697_218109 Ga0466697_218109_120_1112 330
173 3300012854 Ga0160448_100980 Ga0160448_1009804 333
174 3300042591 Ga0466692_177796 Ga0466692_177796_451_1455 334
175 3300042600 Ga0466700_288800 Ga0466700_288800_431_1438 335
176 3300042608 Ga0466721_160541 Ga0466721_160541_19642_20649 335
177 3300042652 Ga0466708_060465 Ga0466708_060465_1430_2440 336
178 3300010167 Ga0123353_10142060 Ga0123353_101420602 348
179 3300012825 Ga0160441_100448 Ga0160441_10044827 359

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF04321 RmlD_sub_bind RmlD substrate binding domain 48 204 0.89
PF01073 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase family 50 174 0.87
PF01370 Epimerase NAD dependent epimerase/dehydratase family 49 277 0.86
PF07993 NAD_binding_4 Male sterility protein 132 261 0.86
PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase 51 213 0.81

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.85 0.9 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.