Protein Family IF03580
Metagenome
Isolate
253
Members
80
Samples
198
Scaffolds
326.61
Avg Length
Representative Sequence
- ID
- 3300012803|Ga0160465_100404|Ga0160465_10040416
- Length
- 370 aa
- Sequence
- VIWWQGVVGQGSDFLPGMGAYGESHNNERRSQIMMTAQYKITALQRAFKLMAYIVVCLFGILATGHLALAAEYPTRPIRIIVPFGAGGLTDIVARLVAERLSKDNAWNVIVENKTGAGGNIGAAEVARSKPDGYTLLMGSIGTNATNPFIYRRMTFDPKKDFAPITLAATGTLLLVVNPALPIHSTKELIDYARQHPGKLSYGSGGMGASQHLAGELLKSMAKIDIQHVPYKGLAPAIPDLLAGRIALTFDMATALPYVKSGKLRAIAVANPERSEALPDVPTIAESGVPGYAASAWYGFFAPAGTPDDIIQLLNKKITGILKLDDIGQRLLAMGAEPAMSTPQELAAYVAAESEKWGKVLKGLNLQLD*
Sample Types
Isolate
20.9%
Metagenome
79.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Formicidae
21.4%
Termitidae
21.4%
Culicidae
12.9%
Armadillidiidae
11.4%
Unclassified
8.6%
Kalotermitidae
7.1%
Elmidae
7.1%
Curculionidae
4.3%
Hydrophilidae
2.9%
Crambidae
1.4%
Alydidae
1.4%
Taxonomy
Archaea
0
Bacteria
215
Eukaryota
0
Viruses
0
Unclassified
38
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 8100455565 | Delftia sp. S67 | Isolate | Curculionidae |
| 2 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 3 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 4 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 5 | 2864826666 | Acidovorax konjaci S00067 | Isolate | Elmidae |
| 6 | 2873571580 | Diaphorobacter sp. HDW4B | Isolate | Hydrophilidae |
| 7 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 8 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 9 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 10 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 11 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 12 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 13 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 14 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 15 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 16 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 17 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 18 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 19 | 2864870719 | Comamonas odontotermitis S00124 | Isolate | Elmidae |
| 20 | 2864937364 | Acidovorax soli S00198 | Isolate | Elmidae |
| 21 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 22 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 23 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 24 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 25 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 26 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 27 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 28 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 29 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 30 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 31 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 32 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 33 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 34 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 35 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 36 | 2687453742 | Burkholderiales bacterium B_Cag20 | Isolate | Unclassified |
| 37 | 2864960361 | Comamonas odontotermitis S00229 | Isolate | Elmidae |
| 38 | 2868169047 | Comamonas aquatica S00077 | Isolate | Elmidae |
| 39 | 8100461708 | Delftia sp. S65 | Isolate | Curculionidae |
| 40 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 41 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 42 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 43 | 3300012806 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG | Metagenome | |
| 44 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 45 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 46 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 47 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 48 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 49 | 2687453753 | Burkholderiales bacterium B_Cag25 | Isolate | Unclassified |
| 50 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 51 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 52 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 53 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 54 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 55 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 56 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 57 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 58 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 59 | 2603880170 | Burkholderiales A2 | Isolate | Unclassified |
| 60 | 2603880172 | Burkholderiales C | Isolate | Unclassified |
| 61 | 2873565274 | Diaphorobacter sp. HDW4A | Isolate | Hydrophilidae |
| 62 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 63 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 64 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 65 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 66 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 67 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 68 | 3300012815 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG | Metagenome | |
| 69 | 2855798354 | Achromobacter insolitus AR476-2 | Isolate | Crambidae |
| 70 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 71 | 8024031916 | Cupriavidus pauculus BHJ32i | Isolate | Alydidae |
| 72 | 8100449422 | Delftia sp. S66 | Isolate | Curculionidae |
| 73 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 74 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 75 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 76 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 77 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 78 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 79 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 80 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123356_10405654 | 3300010049 | Bacteria | 1501 |
| 2 | Ga0160442_104440 | 3300012806 | Unclassified | 1442 |
| 3 | Ga0466697_000921 | 3300042611 | Bacteria | 4194 |
| 4 | Ga0160440_100029 | 3300012815 | Bacteria | 231726 |
| 5 | Ga0160469_100043 | 3300012824 | Bacteria | 213840 |
| 6 | Ga0160469_100061 | 3300012824 | Bacteria | 182119 |
| 7 | Ga0160472_103138 | 3300012839 | Bacteria | 3396 |
| 8 | Ga0160430_101153 | 3300012852 | Bacteria | 10684 |
| 9 | Ga0160435_1001928 | 3300012857 | Unclassified | 5106 |
| 10 | Ga0466693_088416 | 3300042592 | Bacteria | 6567 |
| 11 | Ga0466701_010334 | 3300042598 | Bacteria | 40691 |
| 12 | Ga0466724_16999 | 3300042649 | Bacteria | 89252 |
| 13 | Ga0466724_35850 | 3300042649 | Bacteria | 120573 |
| 14 | CVPL005W_1000646 | 3300002934 | Bacteria | 12491 |
| 15 | Ga0068305_10235330 | 3300005083 | Unclassified | 2678 |
| 16 | Ga0103263_101049 | 3300007042 | Unclassified | 3668 |
| 17 | Ga0103266_1000008 | 3300007067 | Bacteria | 116820 |
| 18 | Ga0103265_1005123 | 3300007068 | Bacteria | 2949 |
| 19 | Ga0102734_1008311 | 3300007129 | Bacteria | 2363 |
| 20 | Ga0102737_1000168 | 3300007142 | Unclassified | 21890 |
| 21 | Ga0103264_1001186 | 3300007188 | Bacteria | 11518 |
| 22 | Ga0103264_1018009 | 3300007188 | Bacteria | 6397 |
| 23 | Ga0466710_149673 | 3300042613 | Bacteria | 1591 |
| 24 | Ga0123355_10357597 | 3300009826 | Unclassified | 1927 |
| 25 | Ga0160465_100404 | 3300012803 | Bacteria | 22953 |
| 26 | Ga0160471_100075 | 3300012812 | Bacteria | 87706 |
| 27 | Ga0466701_027517 | 3300042598 | Unclassified | 29394 |
| 28 | Ga0466701_038054 | 3300042598 | Unclassified | 6359 |
| 29 | Ga0160470_100914 | 3300012813 | Unclassified | 8570 |
| 30 | Ga0160456_100569 | 3300012820 | Bacteria | 11131 |
| 31 | Ga0160469_100047 | 3300012824 | Bacteria | 208696 |
| 32 | Ga0160469_100051 | 3300012824 | Bacteria | 203583 |
| 33 | Ga0160441_100010 | 3300012825 | Bacteria | 490758 |
| 34 | Ga0160444_100005 | 3300012841 | Bacteria | 646301 |
| 35 | Ga0160460_105000 | 3300012845 | Bacteria | 1952 |
| 36 | Ga0160447_100030 | 3300012849 | Bacteria | 210871 |
| 37 | Ga0466657_315469 | 3300042582 | Bacteria | 2707 |
| 38 | Ga0466734_041979 | 3300042623 | Bacteria | 1433 |
| 39 | Ga0466734_046982 | 3300042623 | Bacteria | 1619 |
| 40 | Ga0466730_011115 | 3300042625 | Bacteria | 159275 |
| 41 | Ga0466730_013812 | 3300042625 | Bacteria | 185537 |
| 42 | CVPL010W_10001199 | 3300002931 | Bacteria | 37871 |
| 43 | Ga0103261_1000871 | 3300007083 | Bacteria | 4665 |
| 44 | Ga0102734_1007872 | 3300007129 | Bacteria | 3601 |
| 45 | Ga0103264_1000368 | 3300007188 | Bacteria | 23778 |
| 46 | Ga0103264_1001621 | 3300007188 | Unclassified | 15941 |
| 47 | Ga0466723_024186 | 3300042618 | Bacteria | 12390 |
| 48 | Ga0123354_10203538 | 3300010882 | Bacteria | 2166 |
| 49 | Ga0466701_041511 | 3300042598 | Bacteria | 5620 |
| 50 | Ga0466701_098710 | 3300042598 | Bacteria | 149797 |
| 51 | Ga0466701_102684 | 3300042598 | Bacteria | 104971 |
| 52 | Ga0466713_054082 | 3300042602 | Bacteria | 13838 |
| 53 | Ga0466719_259129 | 3300042606 | Bacteria | 6964 |
| 54 | Ga0466721_026735 | 3300042608 | Unclassified | 1908 |
| 55 | Ga0466721_217159 | 3300042608 | Bacteria | 1409 |
| 56 | Ga0466721_301975 | 3300042608 | Bacteria | 2167 |
| 57 | Ga0160441_105609 | 3300012825 | Bacteria | 1839 |
| 58 | Ga0160472_103057 | 3300012839 | Bacteria | 3474 |
| 59 | Ga0160444_100159 | 3300012841 | Bacteria | 66741 |
| 60 | Ga0160447_101429 | 3300012849 | Bacteria | 9294 |
| 61 | Ga0160435_1004586 | 3300012857 | Bacteria | 3197 |
| 62 | Ga0160436_1009896 | 3300012861 | Unclassified | 2092 |
| 63 | Ga0466657_291758 | 3300042582 | Bacteria | 2161 |
| 64 | Ga0466693_222223 | 3300042592 | Bacteria | 6633 |
| 65 | Ga0466724_25034 | 3300042649 | Bacteria | 837337 |
| 66 | Ga0466724_43634 | 3300042649 | Bacteria | 373148 |
| 67 | Ga0102736_1005200 | 3300007052 | Bacteria | 2932 |
| 68 | Ga0103261_1001609 | 3300007083 | Bacteria | 3590 |
| 69 | Ga0103260_1001335 | 3300007139 | Bacteria | 7208 |
| 70 | Ga0102740_1000275 | 3300007140 | Unclassified | 14602 |
| 71 | Ga0102740_1002225 | 3300007140 | Unclassified | 4534 |
| 72 | Ga0466710_018990 | 3300042613 | Bacteria | 1948 |
| 73 | Ga0466710_187492 | 3300042613 | Bacteria | 2841 |
| 74 | Ga0160465_101576 | 3300012803 | Bacteria | 6360 |
| 75 | Ga0160471_100478 | 3300012812 | Unclassified | 11139 |
| 76 | Ga0160470_100046 | 3300012813 | Bacteria | 181385 |
| 77 | Ga0466701_048605 | 3300042598 | Bacteria | 117003 |
| 78 | Ga0466701_070542 | 3300042598 | Bacteria | 3847 |
| 79 | Ga0160470_100771 | 3300012813 | Bacteria | 9950 |
| 80 | Ga0160453_100062 | 3300012814 | Bacteria | 113502 |
| 81 | Ga0160456_100072 | 3300012820 | Unclassified | 142162 |
| 82 | Ga0160469_100041 | 3300012824 | Bacteria | 219309 |
| 83 | Ga0160458_100741 | 3300012832 | Unclassified | 10182 |
| 84 | Ga0160452_100005 | 3300012834 | Bacteria | 490758 |
| 85 | Ga0160444_100179 | 3300012841 | Bacteria | 58581 |
| 86 | Ga0160430_100090 | 3300012852 | Bacteria | 80044 |
| 87 | Ga0160430_102590 | 3300012852 | Bacteria | 5611 |
| 88 | Ga0160435_1002700 | 3300012857 | Bacteria | 4291 |
| 89 | Ga0160457_1003595 | 3300012858 | Unclassified | 2670 |
| 90 | Ga0160436_1007002 | 3300012861 | Unclassified | 2586 |
| 91 | Ga0466657_035154 | 3300042582 | Bacteria | 1965 |
| 92 | Ga0466657_343879 | 3300042582 | Bacteria | 1421 |
| 93 | Ga0466734_045708 | 3300042623 | Bacteria | 7449 |
| 94 | CVPL005W_1000288 | 3300002934 | Bacteria | 21814 |
| 95 | Ga0102736_1001317 | 3300007052 | Bacteria | 4392 |
| 96 | Ga0103264_1002010 | 3300007188 | Bacteria | 9550 |
| 97 | Ga0103267_1000538 | 3300007190 | Bacteria | 15461 |
| 98 | Ga0123355_10378106 | 3300009826 | Bacteria | 1848 |
| 99 | Ga0123356_10105981 | 3300010049 | Unclassified | 2705 |
| 100 | Ga0160454_101313 | 3300012798 | Bacteria | 3844 |
| 101 | Ga0160465_104838 | 3300012803 | Bacteria | 1927 |
| 102 | Ga0160471_100895 | 3300012812 | Unclassified | 6793 |
| 103 | Ga0160470_100056 | 3300012813 | Bacteria | 164821 |
| 104 | Ga0466701_033099 | 3300042598 | Bacteria | 3426 |
| 105 | Ga0466701_052508 | 3300042598 | Bacteria | 235417 |
| 106 | Ga0466701_086007 | 3300042598 | Bacteria | 43193 |
| 107 | Ga0160470_101092 | 3300012813 | Bacteria | 7345 |
| 108 | Ga0160468_100212 | 3300012819 | Bacteria | 36616 |
| 109 | Ga0160472_101359 | 3300012839 | Bacteria | 7427 |
| 110 | Ga0160472_105195 | 3300012839 | Bacteria | 2131 |
| 111 | Ga0160447_102658 | 3300012849 | Bacteria | 6123 |
| 112 | Ga0160447_109745 | 3300012849 | Bacteria | 2170 |
| 113 | Ga0160430_107019 | 3300012852 | Bacteria | 2318 |
| 114 | Ga0466657_130726 | 3300042582 | Bacteria | 1207 |
| 115 | Ga0466730_001347 | 3300042625 | Unclassified | 34704 |
| 116 | Ga0466730_007701 | 3300042625 | Bacteria | 130976 |
| 117 | Ga0103261_1001128 | 3300007083 | Bacteria | 4776 |
| 118 | Ga0102734_1002837 | 3300007129 | Unclassified | 5771 |
| 119 | Ga0102737_1009451 | 3300007142 | Unclassified | 1676 |
| 120 | Ga0103264_1000910 | 3300007188 | Bacteria | 13319 |
| 121 | Ga0466728_248439 | 3300042620 | Bacteria | 27319 |
| 122 | Ga0123355_10294139 | 3300009826 | Bacteria | 2224 |
| 123 | Ga0123356_10143641 | 3300010049 | Bacteria | 2358 |
| 124 | Ga0160465_103159 | 3300012803 | Bacteria | 3149 |
| 125 | Ga0466701_028073 | 3300042598 | Bacteria | 1634 |
| 126 | Ga0466701_074178 | 3300042598 | Unclassified | 3683 |
| 127 | Ga0466701_085381 | 3300042598 | Bacteria | 4824 |
| 128 | Ga0160456_100059 | 3300012820 | Bacteria | 166063 |
| 129 | Ga0160452_107127 | 3300012834 | Bacteria | 1502 |
| 130 | Ga0160433_102573 | 3300012846 | Bacteria | 3792 |
| 131 | Ga0466657_100047 | 3300042582 | Bacteria | 1104 |
| 132 | Ga0466701_002704 | 3300042598 | Unclassified | 2383 |
| 133 | Ga0466730_038558 | 3300042625 | Bacteria | 566435 |
| 134 | Ga0466730_071840 | 3300042625 | Unclassified | 44056 |
| 135 | Ga0466724_43702 | 3300042649 | Bacteria | 16437 |
| 136 | Ga0466724_58595 | 3300042649 | Bacteria | 137649 |
| 137 | Ga0466724_62229 | 3300042649 | Unclassified | 15105 |
| 138 | CVPL010W_10013871 | 3300002931 | Bacteria | 6031 |
| 139 | Ga0103264_1000647 | 3300007188 | Bacteria | 21417 |
| 140 | Ga0103268_1000680 | 3300007192 | Unclassified | 9791 |
| 141 | Ga0123354_10010762 | 3300010882 | Bacteria | 14114 |
| 142 | Ga0160454_100393 | 3300012798 | Bacteria | 22527 |
| 143 | Ga0160454_100647 | 3300012798 | Bacteria | 8060 |
| 144 | Ga0160465_100027 | 3300012803 | Bacteria | 211818 |
| 145 | Ga0160465_101529 | 3300012803 | Bacteria | 6547 |
| 146 | Ga0160466_102126 | 3300012809 | Bacteria | 4249 |
| 147 | Ga0466701_038088 | 3300042598 | Bacteria | 3681 |
| 148 | Ga0466701_095768 | 3300042598 | Bacteria | 5052 |
| 149 | Ga0466721_064898 | 3300042608 | Unclassified | 1111 |
| 150 | Ga0160456_100281 | 3300012820 | Bacteria | 21658 |
| 151 | Ga0160456_100410 | 3300012820 | Bacteria | 14568 |
| 152 | Ga0160431_100088 | 3300012828 | Bacteria | 71491 |
| 153 | Ga0160459_100088 | 3300012831 | Bacteria | 102895 |
| 154 | Ga0160472_101238 | 3300012839 | Bacteria | 8149 |
| 155 | Ga0160445_100008 | 3300012847 | Unclassified | 318878 |
| 156 | Ga0466656_133707 | 3300042550 | Bacteria | 5185 |
| 157 | Ga0466730_055911 | 3300042625 | Bacteria | 12879 |
| 158 | Ga0466724_42462 | 3300042649 | Bacteria | 351483 |
| 159 | Ga0466708_252678 | 3300042652 | Bacteria | 7140 |
| 160 | JGI24705J35276_12236968 | 3300002504 | Bacteria | 9448 |
| 161 | CVPL010W_10020046 | 3300002931 | Bacteria | 3921 |
| 162 | Ga0102737_1008208 | 3300007142 | Bacteria | 1859 |
| 163 | Ga0102737_1013738 | 3300007142 | Unclassified | 1309 |
| 164 | Ga0466715_412947 | 3300042616 | Bacteria | 4118 |
| 165 | Ga0123357_10104972 | 3300009784 | Bacteria | 3626 |
| 166 | Ga0123356_10523946 | 3300010049 | Bacteria | 1344 |
| 167 | Ga0123354_10001863 | 3300010882 | Bacteria | 26693 |
| 168 | Ga0466701_027539 | 3300042598 | Unclassified | 35933 |
| 169 | Ga0466701_041319 | 3300042598 | Bacteria | 27981 |
| 170 | Ga0466701_044464 | 3300042598 | Bacteria | 300143 |
| 171 | Ga0160470_100201 | 3300012813 | Unclassified | 51085 |
| 172 | Ga0160468_101064 | 3300012819 | Bacteria | 7919 |
| 173 | Ga0160456_101206 | 3300012820 | Bacteria | 6514 |
| 174 | Ga0160456_104987 | 3300012820 | Bacteria | 1666 |
| 175 | Ga0160469_100024 | 3300012824 | Bacteria | 306500 |
| 176 | Ga0160469_100597 | 3300012824 | Unclassified | 14575 |
| 177 | Ga0160459_100041 | 3300012831 | Bacteria | 228416 |
| 178 | Ga0160455_100012 | 3300012837 | Bacteria | 588253 |
| 179 | Ga0160472_100105 | 3300012839 | Bacteria | 135252 |
| 180 | Ga0160472_101989 | 3300012839 | Bacteria | 5067 |
| 181 | Ga0160472_102155 | 3300012839 | Bacteria | 4723 |
| 182 | Ga0160444_100004 | 3300012841 | Bacteria | 649715 |
| 183 | Ga0160460_103157 | 3300012845 | Bacteria | 3073 |
| 184 | Ga0160447_101553 | 3300012849 | Bacteria | 8836 |
| 185 | Ga0160447_107435 | 3300012849 | Bacteria | 2741 |
| 186 | Ga0160435_1004412 | 3300012857 | Bacteria | 3257 |
| 187 | Ga0466730_056495 | 3300042625 | Bacteria | 3140 |
| 188 | Ga0466730_062339 | 3300042625 | Bacteria | 155913 |
| 189 | Ga0466724_49390 | 3300042649 | Unclassified | 11771 |
| 190 | Ga0466724_57906 | 3300042649 | Bacteria | 581904 |
| 191 | Ga0466708_120368 | 3300042652 | Bacteria | 5495 |
| 192 | CVPL010W_10003849 | 3300002931 | Bacteria | 25974 |
| 193 | Ga0102739_1000523 | 3300007095 | Bacteria | 7619 |
| 194 | Ga0102740_1001457 | 3300007140 | Unclassified | 5999 |
| 195 | Ga0102740_1001762 | 3300007140 | Unclassified | 5298 |
| 196 | Ga0102737_1005218 | 3300007142 | Bacteria | 2621 |
| 197 | Ga0103268_1000316 | 3300007192 | Bacteria | 15678 |
| 198 | Ga0466710_102500 | 3300042613 | Bacteria | 2555 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF03401 | TctC | Tripartite tricarboxylate transporter family receptor | 93 | 366 | 0.99 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.