Protein Family IF03553
Metagenome
Isolate
113
Members
38
Samples
109
Scaffolds
109.82
Avg Length
Representative Sequence
- ID
- 3300010882|Ga0123354_10385317|Ga0123354_103853172
- Length
- 119 aa
- Sequence
- MKKVLFTPEVTGYIDFLIPLLYELGYFRDKEKARKYFKELVDDIKKNLPIRQHNPAPPYFHKFLNYMEHAENMEYTSFRKNKNTAWYAFFTTYEDEETGEDIYLVCYIANNHTVAQHL*
Sample Types
Isolate
3.5%
Metagenome
96.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
81.1%
Unclassified
8.1%
Kalotermitidae
2.7%
Drosophilidae
2.7%
Passalidae
2.7%
Termopsidae
2.7%
Taxonomy
Archaea
0
Bacteria
103
Eukaryota
0
Viruses
0
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 2 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 3 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 4 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 5 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 6 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 7 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 8 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 9 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 10 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 11 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 12 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 13 | 2820744581 | Unclassified Bacteroidetes Th196P3bin138 | Isolate | Unclassified |
| 14 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 15 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 16 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 17 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 18 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 19 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 20 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 21 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 22 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 23 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 24 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 25 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 26 | 3300005308 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 1 gut | Metagenome | Drosophilidae |
| 27 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 28 | 2820789850 | Unclassified Bacteroidetes Cu122P3bin3 | Isolate | Unclassified |
| 29 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 30 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 31 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 32 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 33 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 34 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 35 | 2820737921 | Unclassified Bacteroidetes Th196P4bin18 | Isolate | Unclassified |
| 36 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 37 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 38 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_113946 | 3300042611 | Bacteria | 1654 |
| 2 | Ga0466697_179409 | 3300042611 | Bacteria | 152612 |
| 3 | Ga0466733_035126 | 3300042659 | Bacteria | 1394 |
| 4 | JGI24702J35022_10311040 | 3300002462 | Bacteria | 932 |
| 5 | Ga0072940_1004554 | 3300005200 | Bacteria | 6385 |
| 6 | Ga0123357_10126563 | 3300009784 | Bacteria | 3198 |
| 7 | Ga0123356_10618860 | 3300010049 | Bacteria | 1248 |
| 8 | Ga0123356_11131100 | 3300010049 | Bacteria | 951 |
| 9 | Ga0123356_11225251 | 3300010049 | Bacteria | 916 |
| 10 | Ga0466693_404287 | 3300042592 | Bacteria | 1093 |
| 11 | Ga0466699_042492 | 3300042597 | Bacteria | 2973 |
| 12 | Ga0466728_042159 | 3300042620 | Bacteria | 2381 |
| 13 | Ga0466731_276990 | 3300042622 | Bacteria | 3448 |
| 14 | Ga0466702_195248 | 3300042635 | Bacteria | 2532 |
| 15 | Ga0466697_081038 | 3300042611 | Bacteria | 1251 |
| 16 | Ga0123356_10955641 | 3300010049 | Unclassified | 1028 |
| 17 | Ga0123353_10068495 | 3300010167 | Bacteria | 5699 |
| 18 | Ga0123353_10496867 | 3300010167 | Bacteria | 1779 |
| 19 | Ga0123354_10002568 | 3300010882 | Bacteria | 24173 |
| 20 | Ga0123354_10269916 | 3300010882 | Unclassified | 1677 |
| 21 | Ga0123354_10549603 | 3300010882 | Bacteria | 871 |
| 22 | Ga0466710_384418 | 3300042613 | Bacteria | 1332 |
| 23 | Ga0074310_1132729 | 3300005308 | Bacteria | 692 |
| 24 | Ga0123356_11772868 | 3300010049 | Bacteria | 767 |
| 25 | Ga0123353_10000008 | 3300010167 | Bacteria | 264409 |
| 26 | Ga0123353_10571896 | 3300010167 | Bacteria | 1624 |
| 27 | Ga0123353_11183173 | 3300010167 | Bacteria | 1005 |
| 28 | Ga0123354_10059562 | 3300010882 | Unclassified | 5660 |
| 29 | Ga0415639_070677 | 3300038395 | Bacteria | 2546 |
| 30 | Ga0466712_037652 | 3300042614 | Unclassified | 9395 |
| 31 | Ga0466701_101863 | 3300042598 | Bacteria | 1156 |
| 32 | Ga0466724_68726 | 3300042649 | Bacteria | 3596 |
| 33 | Ga0466697_256651 | 3300042611 | Bacteria | 2103 |
| 34 | IMNBL1DRAFT_c0042774 | 3300000062 | Bacteria | 1507 |
| 35 | JGI24698J34947_10108623 | 3300002449 | Bacteria | 1229 |
| 36 | JGI24702J35022_10635789 | 3300002462 | Bacteria | 661 |
| 37 | JGI24696J40584_12811117 | 3300002834 | Unclassified | 888 |
| 38 | Ga0072940_1212508 | 3300005200 | Bacteria | 1651 |
| 39 | Ga0123355_10666073 | 3300009826 | Bacteria | 1208 |
| 40 | Ga0123356_10132027 | 3300010049 | Bacteria | 2448 |
| 41 | Ga0123356_12617047 | 3300010049 | Bacteria | 632 |
| 42 | Ga0123356_12908042 | 3300010049 | Bacteria | 599 |
| 43 | Ga0123353_10058813 | 3300010167 | Bacteria | 6160 |
| 44 | Ga0123353_10751055 | 3300010167 | Unclassified | 1358 |
| 45 | Ga0466693_008100 | 3300042592 | Bacteria | 1161 |
| 46 | Ga0466693_035216 | 3300042592 | Bacteria | 1023 |
| 47 | Ga0466721_015774 | 3300042608 | Bacteria | 1410 |
| 48 | Ga0466731_214219 | 3300042622 | Bacteria | 1349 |
| 49 | Ga0466725_388310 | 3300042654 | Bacteria | 27493 |
| 50 | Ga0466733_195321 | 3300042659 | Bacteria | 2857 |
| 51 | JGI24702J35022_10127226 | 3300002462 | Bacteria | 1412 |
| 52 | JGI24702J35022_11019248 | 3300002462 | Bacteria | 515 |
| 53 | JGI24705J35276_11727587 | 3300002504 | Bacteria | 646 |
| 54 | JGI24705J35276_12006919 | 3300002504 | Bacteria | 856 |
| 55 | JGI24696J40584_12512514 | 3300002834 | Bacteria | 605 |
| 56 | JGI24696J40584_12876534 | 3300002834 | Bacteria | 1067 |
| 57 | JGI24696J40584_12948762 | 3300002834 | Bacteria | 2025 |
| 58 | Ga0072941_1302637 | 3300005201 | Bacteria | 905 |
| 59 | Ga0123356_11502523 | 3300010049 | Bacteria | 831 |
| 60 | Ga0123353_11253970 | 3300010167 | Bacteria | 967 |
| 61 | Ga0123353_12622326 | 3300010167 | Bacteria | 596 |
| 62 | Ga0466693_351267 | 3300042592 | Bacteria | 1007 |
| 63 | Ga0466694_104548 | 3300042594 | Bacteria | 1408 |
| 64 | Ga0466718_132153 | 3300042617 | Bacteria | 1145 |
| 65 | Ga0466698_300005 | 3300042610 | Bacteria | 1151 |
| 66 | JGI24698J34947_10211789 | 3300002449 | Bacteria | 750 |
| 67 | JGI24702J35022_10069211 | 3300002462 | Bacteria | 1898 |
| 68 | JGI24705J35276_12031338 | 3300002504 | Bacteria | 889 |
| 69 | JGI24696J40584_12934818 | 3300002834 | Unclassified | 1547 |
| 70 | JGI24696J40584_12935996 | 3300002834 | Bacteria | 1571 |
| 71 | Ga0072941_1153217 | 3300005201 | Bacteria | 8372 |
| 72 | Ga0072941_1247393 | 3300005201 | Bacteria | 3305 |
| 73 | Ga0123356_10054425 | 3300010049 | Bacteria | 3727 |
| 74 | Ga0123356_10137003 | 3300010049 | Bacteria | 2408 |
| 75 | Ga0123356_11451039 | 3300010049 | Bacteria | 845 |
| 76 | Ga0123354_10385317 | 3300010882 | Unclassified | 1205 |
| 77 | Ga0123354_10424792 | 3300010882 | Bacteria | 1101 |
| 78 | Ga0123354_10426034 | 3300010882 | Bacteria | 1098 |
| 79 | Ga0466710_167433 | 3300042613 | Unclassified | 1003 |
| 80 | Ga0466712_106679 | 3300042614 | Bacteria | 1066 |
| 81 | Ga0466718_145061 | 3300042617 | Bacteria | 1296 |
| 82 | Ga0466717_032129 | 3300042604 | Bacteria | 1343 |
| 83 | JGI24698J34947_10178014 | 3300002449 | Bacteria | 853 |
| 84 | JGI24702J35022_10529659 | 3300002462 | Bacteria | 725 |
| 85 | Ga0072941_1159460 | 3300005201 | Bacteria | 1325 |
| 86 | Ga0123356_10259948 | 3300010049 | Bacteria | 1819 |
| 87 | Ga0123353_10870337 | 3300010167 | Unclassified | 1232 |
| 88 | Ga0123354_10046224 | 3300010882 | Bacteria | 6654 |
| 89 | Ga0466656_083003 | 3300042550 | Bacteria | 1071 |
| 90 | Ga0466699_244050 | 3300042597 | Bacteria | 1084 |
| 91 | Ga0466710_138313 | 3300042613 | Bacteria | 1850 |
| 92 | Ga0466701_065318 | 3300042598 | Bacteria | 1140 |
| 93 | Ga0466714_020370 | 3300042603 | Bacteria | 64985 |
| 94 | Ga0466717_058751 | 3300042604 | Bacteria | 2292 |
| 95 | Ga0466717_192537 | 3300042604 | Bacteria | 1767 |
| 96 | Ga0466721_083013 | 3300042608 | Bacteria | 2686 |
| 97 | Ga0466734_130791 | 3300042623 | Bacteria | 1357 |
| 98 | Ga0466725_004818 | 3300042654 | Bacteria | 2045 |
| 99 | Ga0466727_161591 | 3300042655 | Bacteria | 1391 |
| 100 | JGI24702J35022_10006984 | 3300002462 | Bacteria | 6488 |
| 101 | JGI24702J35022_10576343 | 3300002462 | Bacteria | 695 |
| 102 | JGI24696J40584_12811036 | 3300002834 | Bacteria | 888 |
| 103 | Ga0072941_1001408 | 3300005201 | Bacteria | 675 |
| 104 | Ga0123355_11140680 | 3300009826 | Bacteria | 805 |
| 105 | Ga0123355_11307040 | 3300009826 | Bacteria | 727 |
| 106 | Ga0123356_10162897 | 3300010049 | Bacteria | 2231 |
| 107 | Ga0123353_12876014 | 3300010167 | Bacteria | 562 |
| 108 | Ga0466656_139418 | 3300042550 | Bacteria | 2750 |
| 109 | Ga0466701_094131 | 3300042598 | Bacteria | 5298 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.