Protein Family IF03501
Metagenome
Metatranscriptome
Isolate
190
Members
66
Samples
164
Scaffolds
188.45
Avg Length
Representative Sequence
- ID
- 3300010882|Ga0123354_10089104|Ga0123354_100891046
- Length
- 224 aa
- Sequence
- MTYGGRISLTKYPRDVYGYGISAWPIGPVSILRMGKMSLIGKEVADFSVQAFDKDDFRTVTKADLLGKWSVFVFYPADFTFVCPTELGDLADLYPEFTKIGCEIYSVSCDTHWVHKAWKDASDTIKKIKYPMLADPTHALAQDFDVMIEADGVAERGSFVINPEGKIVAYEVNGGSVGRSAHELLRRVEASQFVATHDDQVCPANWEPGSKTLAPTLDLVGMI*
Sample Types
Isolate
13.7%
Metagenome
85.8%
MAG
0.0%
Metatranscriptome
0.5%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
22.7%
Kalotermitidae
21.2%
Unclassified
18.2%
Blattidae
18.2%
Formicidae
7.6%
Rhinotermitidae
4.5%
Drosophilidae
3.0%
Hodotermitidae
1.5%
Hydrophilidae
1.5%
Passalidae
1.5%
Taxonomy
Archaea
2
Bacteria
173
Eukaryota
0
Viruses
0
Unclassified
15
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125683 | Treponema sp. Lab288P1bin34 | Isolate | Unclassified |
| 2 | 2820901319 | Unclassified Actinobacteria Emb289P4bin58 | Isolate | Unclassified |
| 3 | 2820944107 | Unclassified Actinobacteria Cu122P5bin14 | Isolate | Unclassified |
| 4 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 5 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 6 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 7 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 8 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 9 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 10 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 11 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 12 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 13 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 14 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 15 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 16 | 2820619171 | Unclassified Firmicutes Emb289P1bin130 | Isolate | Unclassified |
| 17 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 18 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 19 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 20 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 21 | 2940373808 | Fusobacterium sp. PH5-7 | Isolate | Blattidae |
| 22 | 2873595552 | Erysipelothrix sp. HDW6C | Isolate | Hydrophilidae |
| 23 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 24 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 25 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 26 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 27 | 2820298281 | Unclassified Firmicutes Th196P1bin9 | Isolate | Unclassified |
| 28 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 29 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 30 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 31 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 32 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 33 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 34 | 2820479655 | Unclassified Firmicutes Lab288P1bin77 | Isolate | Unclassified |
| 35 | 2963630348 | Burkholderiales bacterium 3487_49 | Isolate | Formicidae |
| 36 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 37 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 38 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 39 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 40 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 41 | 3300038763 | Termite gut microbial communities of Labiotermes labralis from French Guiana - 62_rP2 | Metatranscriptome | Termitidae |
| 42 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 43 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 44 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 45 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 46 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 47 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 48 | 2821314491 | Unclassified Actinobacteria Lab288P4bin49 | Isolate | Unclassified |
| 49 | 2902668162 | Lacticaseibacillus paracasei DmW_181 | Isolate | Drosophilidae |
| 50 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 51 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 52 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 53 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 54 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 55 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 56 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 57 | 2820840446 | Unclassified Actinobacteria Lab288P4bin17 | Isolate | Unclassified |
| 58 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 59 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 60 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 61 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 62 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 63 | 2781125632 | Treponema sp. Co191P1bin87 | Isolate | Unclassified |
| 64 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 65 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 66 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_027773 | 3300042612 | Bacteria | 15705 |
| 2 | Ga0466705_378348 | 3300042612 | Bacteria | 3745 |
| 3 | Ga0466704_487361 | 3300042643 | Bacteria | 16773 |
| 4 | Ga0466708_420659 | 3300042652 | Bacteria | 5453 |
| 5 | Ga0466715_166263 | 3300042616 | Bacteria | 2991 |
| 6 | Ga0466728_139126 | 3300042620 | Bacteria | 1296 |
| 7 | Ga0466690_229067 | 3300042590 | Bacteria | 3834 |
| 8 | Ga0123355_10149113 | 3300009826 | Bacteria | 3558 |
| 9 | Ga0123356_10571029 | 3300010049 | Bacteria | 1294 |
| 10 | JGI24695J34938_10009297 | 3300002450 | Bacteria | 5478 |
| 11 | Ga0103266_1002703 | 3300007067 | Bacteria | 2684 |
| 12 | Ga0466705_031578 | 3300042612 | Bacteria | 7092 |
| 13 | Ga0466705_270082 | 3300042612 | Unclassified | 1148 |
| 14 | Ga0466703_207668 | 3300042636 | Bacteria | 20271 |
| 15 | Ga0466704_386259 | 3300042643 | Bacteria | 1359 |
| 16 | Ga0466690_386696 | 3300042590 | Bacteria | 2548 |
| 17 | Ga0466690_393476 | 3300042590 | Bacteria | 1362 |
| 18 | Ga0466696_123366 | 3300042596 | Bacteria | 1059 |
| 19 | Ga0466696_164854 | 3300042596 | Bacteria | 3284 |
| 20 | Ga0466696_270555 | 3300042596 | Bacteria | 34606 |
| 21 | Ga0466696_420188 | 3300042596 | Bacteria | 2276 |
| 22 | Ga0466706_003744 | 3300042599 | Bacteria | 5876 |
| 23 | Ga0466716_543928 | 3300042605 | Bacteria | 1396 |
| 24 | Ga0123355_10001303 | 3300009826 | Bacteria | 34813 |
| 25 | Ga0123355_10002993 | 3300009826 | Bacteria | 24041 |
| 26 | Ga0123355_10012837 | 3300009826 | Bacteria | 12997 |
| 27 | Ga0123355_10095816 | 3300009826 | Bacteria | 4688 |
| 28 | Ga0123356_10292755 | 3300010049 | Bacteria | 1729 |
| 29 | Ga0123354_10159701 | 3300010882 | Bacteria | 2683 |
| 30 | JGI24705J35276_12210318 | 3300002504 | Unclassified | 1822 |
| 31 | Ga0466697_236553 | 3300042611 | Bacteria | 3775 |
| 32 | Ga0466704_334797 | 3300042643 | Bacteria | 3839 |
| 33 | Ga0466704_432955 | 3300042643 | Bacteria | 7192 |
| 34 | Ga0466704_517150 | 3300042643 | Unclassified | 2508 |
| 35 | Ga0466704_546323 | 3300042643 | Bacteria | 22587 |
| 36 | Ga0466704_560036 | 3300042643 | Bacteria | 13006 |
| 37 | Ga0466709_086970 | 3300042648 | Bacteria | 1666 |
| 38 | Ga0466708_043386 | 3300042652 | Bacteria | 1542 |
| 39 | Ga0466708_231890 | 3300042652 | Bacteria | 29641 |
| 40 | Ga0466708_266644 | 3300042652 | Bacteria | 1621 |
| 41 | Ga0466711_129059 | 3300042615 | Bacteria | 1036 |
| 42 | Ga0466715_037947 | 3300042616 | Bacteria | 4388 |
| 43 | Ga0466715_120598 | 3300042616 | Bacteria | 2174 |
| 44 | Ga0466715_123877 | 3300042616 | Bacteria | 15621 |
| 45 | Ga0466715_172754 | 3300042616 | Bacteria | 5282 |
| 46 | Ga0466715_352114 | 3300042616 | Unclassified | 5531 |
| 47 | Ga0466723_163120 | 3300042618 | Bacteria | 30495 |
| 48 | Ga0466723_166325 | 3300042618 | Bacteria | 59473 |
| 49 | Ga0466728_380810 | 3300042620 | Bacteria | 3641 |
| 50 | Ga0466657_115546 | 3300042582 | Bacteria | 13928 |
| 51 | Ga0466696_140323 | 3300042596 | Unclassified | 2855 |
| 52 | Ga0466696_324398 | 3300042596 | Bacteria | 2005 |
| 53 | Ga0466707_345219 | 3300042601 | Bacteria | 3479 |
| 54 | Ga0466719_046957 | 3300042606 | Bacteria | 7170 |
| 55 | Ga0123355_10004524 | 3300009826 | Bacteria | 20227 |
| 56 | IMNBL1DRAFT_c0030598 | 3300000062 | Bacteria | 1971 |
| 57 | JGI24700J35501_10928132 | 3300002508 | Bacteria | 7378 |
| 58 | Ga0466697_135924 | 3300042611 | Bacteria | 1080 |
| 59 | Ga0466705_032756 | 3300042612 | Bacteria | 12796 |
| 60 | Ga0466705_337589 | 3300042612 | Bacteria | 13829 |
| 61 | Ga0466708_159939 | 3300042652 | Bacteria | 1947 |
| 62 | Ga0466705_428942 | 3300042612 | Bacteria | 8852 |
| 63 | Ga0466711_206671 | 3300042615 | Bacteria | 2972 |
| 64 | Ga0466715_564298 | 3300042616 | Unclassified | 2800 |
| 65 | Ga0466723_084146 | 3300042618 | Bacteria | 8690 |
| 66 | Ga0466723_280319 | 3300042618 | Bacteria | 9635 |
| 67 | Ga0466728_353626 | 3300042620 | Bacteria | 1468 |
| 68 | Ga0466729_161776 | 3300042621 | Bacteria | 3938 |
| 69 | Ga0466690_239128 | 3300042590 | Bacteria | 1385 |
| 70 | Ga0466696_267921 | 3300042596 | Unclassified | 3912 |
| 71 | Ga0466696_375489 | 3300042596 | Bacteria | 3193 |
| 72 | Ga0466696_388125 | 3300042596 | Bacteria | 1762 |
| 73 | Ga0466713_100528 | 3300042602 | Bacteria | 510720 |
| 74 | Ga0466722_073469 | 3300042609 | Bacteria | 23026 |
| 75 | Ga0123357_10133822 | 3300009784 | Unclassified | 3074 |
| 76 | Ga0123355_10006113 | 3300009826 | Bacteria | 17765 |
| 77 | Ga0123355_10344900 | 3300009826 | Bacteria | 1980 |
| 78 | JGI24695J34938_10002998 | 3300002450 | Bacteria | 12149 |
| 79 | JGI24703J35330_11696727 | 3300002501 | Bacteria | 1973 |
| 80 | Ga0123357_10000072 | 3300009784 | Bacteria | 80691 |
| 81 | Ga0466705_184607 | 3300042612 | Bacteria | 14332 |
| 82 | Ga0466705_313075 | 3300042612 | Bacteria | 24664 |
| 83 | Ga0466709_275042 | 3300042648 | Bacteria | 8776 |
| 84 | Ga0466708_081635 | 3300042652 | Bacteria | 63753 |
| 85 | Ga0466708_156117 | 3300042652 | Bacteria | 1061 |
| 86 | Ga0466708_362723 | 3300042652 | Bacteria | 4241 |
| 87 | Ga0466705_500345 | 3300042612 | Bacteria | 7491 |
| 88 | Ga0466715_079488 | 3300042616 | Bacteria | 17871 |
| 89 | Ga0466715_196881 | 3300042616 | Bacteria | 29718 |
| 90 | Ga0466715_522103 | 3300042616 | Bacteria | 5266 |
| 91 | Ga0466723_057445 | 3300042618 | Bacteria | 11645 |
| 92 | Ga0466723_201390 | 3300042618 | Bacteria | 19613 |
| 93 | Ga0466691_040871 | 3300042593 | Bacteria | 8562 |
| 94 | Ga0466696_114619 | 3300042596 | Bacteria | 6605 |
| 95 | Ga0466701_070483 | 3300042598 | Bacteria | 1088 |
| 96 | Ga0466719_162443 | 3300042606 | Bacteria | 9108 |
| 97 | Ga0466719_426970 | 3300042606 | Bacteria | 10461 |
| 98 | Ga0123357_10465177 | 3300009784 | Bacteria | 1083 |
| 99 | Ga0123355_10586521 | 3300009826 | Bacteria | 1330 |
| 100 | IMNBL1DRAFT_c0000017 | 3300000062 | Archaea | 175907 |
| 101 | Ga0102738_1000103 | 3300007141 | Bacteria | 29577 |
| 102 | Ga0123357_10001739 | 3300009784 | Bacteria | 23526 |
| 103 | Ga0466708_009987 | 3300042652 | Bacteria | 1984 |
| 104 | Ga0466711_112756 | 3300042615 | Bacteria | 1580 |
| 105 | Ga0466711_452126 | 3300042615 | Bacteria | 1052 |
| 106 | Ga0466715_031072 | 3300042616 | Bacteria | 8865 |
| 107 | Ga0466723_228450 | 3300042618 | Bacteria | 8848 |
| 108 | Ga0466696_153538 | 3300042596 | Bacteria | 3970 |
| 109 | Ga0466719_019586 | 3300042606 | Bacteria | 3450 |
| 110 | Ga0123357_10296431 | 3300009784 | Bacteria | 1642 |
| 111 | Ga0123355_10111720 | 3300009826 | Bacteria | 4267 |
| 112 | Ga0123355_10374933 | 3300009826 | Bacteria | 1860 |
| 113 | Ga0123353_10785012 | 3300010167 | Unclassified | 1318 |
| 114 | Ga0123354_10237626 | 3300010882 | Bacteria | 1884 |
| 115 | Ga0123357_10001000 | 3300009784 | Bacteria | 28944 |
| 116 | Ga0466705_310149 | 3300042612 | Unclassified | 1730 |
| 117 | Ga0466705_351208 | 3300042612 | Bacteria | 4774 |
| 118 | Ga0466703_111628 | 3300042636 | Bacteria | 11536 |
| 119 | Ga0466708_367863 | 3300042652 | Bacteria | 1048 |
| 120 | Ga0466715_080952 | 3300042616 | Bacteria | 10505 |
| 121 | Ga0466715_220122 | 3300042616 | Bacteria | 4290 |
| 122 | Ga0466723_061660 | 3300042618 | Bacteria | 4427 |
| 123 | Ga0466728_024517 | 3300042620 | Bacteria | 21124 |
| 124 | Ga0466728_389414 | 3300042620 | Bacteria | 4977 |
| 125 | Ga0399895_016078 | 3300038763 | Bacteria | 650 |
| 126 | Ga0466696_107334 | 3300042596 | Bacteria | 1265 |
| 127 | Ga0466716_230700 | 3300042605 | Bacteria | 5866 |
| 128 | Ga0466716_427159 | 3300042605 | Unclassified | 3067 |
| 129 | Ga0466719_165416 | 3300042606 | Unclassified | 3039 |
| 130 | Ga0466719_273657 | 3300042606 | Bacteria | 6245 |
| 131 | Ga0466698_218664 | 3300042610 | Bacteria | 2968 |
| 132 | Ga0123357_10186246 | 3300009784 | Unclassified | 2407 |
| 133 | Ga0123355_10079380 | 3300009826 | Bacteria | 5241 |
| 134 | Ga0123356_11023364 | 3300010049 | Bacteria | 996 |
| 135 | Ga0123354_10004267 | 3300010882 | Bacteria | 20185 |
| 136 | Ga0123354_10033530 | 3300010882 | Bacteria | 8037 |
| 137 | Ga0123354_10312304 | 3300010882 | Bacteria | 1465 |
| 138 | JGI24695J34938_10004614 | 3300002450 | Bacteria | 8952 |
| 139 | JGI24705J35276_12213739 | 3300002504 | Bacteria | 1935 |
| 140 | Ga0103268_1009291 | 3300007192 | Unclassified | 2036 |
| 141 | Ga0123357_10000315 | 3300009784 | Bacteria | 46147 |
| 142 | Ga0466705_339160 | 3300042612 | Bacteria | 4499 |
| 143 | Ga0466734_034000 | 3300042623 | Archaea | 12531 |
| 144 | Ga0466703_241339 | 3300042636 | Bacteria | 173816 |
| 145 | Ga0466704_341413 | 3300042643 | Bacteria | 3222 |
| 146 | Ga0466704_504066 | 3300042643 | Bacteria | 14725 |
| 147 | Ga0466709_227980 | 3300042648 | Bacteria | 21031 |
| 148 | Ga0466708_145305 | 3300042652 | Bacteria | 7071 |
| 149 | Ga0466711_322760 | 3300042615 | Bacteria | 8615 |
| 150 | Ga0466715_126620 | 3300042616 | Bacteria | 2218 |
| 151 | Ga0466715_201645 | 3300042616 | Bacteria | 4142 |
| 152 | Ga0466715_536131 | 3300042616 | Bacteria | 1289 |
| 153 | Ga0466723_048932 | 3300042618 | Bacteria | 3156 |
| 154 | Ga0466723_369311 | 3300042618 | Unclassified | 2299 |
| 155 | Ga0466690_307629 | 3300042590 | Bacteria | 1670 |
| 156 | Ga0466690_333017 | 3300042590 | Bacteria | 1737 |
| 157 | Ga0466707_370183 | 3300042601 | Bacteria | 4645 |
| 158 | Ga0466719_192858 | 3300042606 | Bacteria | 1329 |
| 159 | Ga0123357_10035473 | 3300009784 | Bacteria | 6781 |
| 160 | Ga0123354_10011820 | 3300010882 | Bacteria | 13515 |
| 161 | Ga0123354_10089104 | 3300010882 | Bacteria | 4285 |
| 162 | CVPL010W_10005466 | 3300002931 | Bacteria | 13557 |
| 163 | Ga0104048_1171092 | 3300007143 | Bacteria | 1547 |
| 164 | Ga0123357_10000006 | 3300009784 | Bacteria | 279835 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF08534 | GO:0016491 | oxidoreductase activity | MF |
| PF10417 | GO:0051920 | peroxiredoxin activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.