Protein Family IF03489
Metagenome
Isolate
248
Members
66
Samples
238
Scaffolds
225.63
Avg Length
Representative Sequence
- ID
- 3300010882|Ga0123354_10054821|Ga0123354_100548215
- Length
- 271 aa
- Sequence
- MLLSGNVLLFSKVLKKRVSQFKNLHAFLILNQNKSVIQLLKHTVMIKTVNLQKIFRTEEVETWALNNVSLEINDGEFVAVMGPSGCGKTTLLNILGLLDNPTGGEYYLNDIEVSKYTEKQRTKLRKGVIGFVFQSFNLIDELNVYENIELPLLYMGVSSSERKKRIQETMDRMEISHRTKHFPQQLSGGQQQRVAITRAVVANPKLILADEPTGNLDSKNGKEVMDLLTELNADGTTIVMVTHSQHDAGYARRIINLFDGQLVTEVINKM*
Sample Types
Isolate
4.0%
Metagenome
96.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
46.2%
Kalotermitidae
20.0%
Unclassified
9.2%
Blattidae
9.2%
Termopsidae
6.2%
Passalidae
4.6%
Rhinotermitidae
3.1%
Hodotermitidae
1.5%
Taxonomy
Archaea
0
Bacteria
208
Eukaryota
0
Viruses
0
Unclassified
40
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2894649344 | Allomuricauda alvinocaridis SCR12 | Isolate | Unclassified |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 4 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 5 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 6 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 7 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 8 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 9 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 10 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 11 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 12 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 13 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 14 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 15 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 16 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 17 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 18 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 19 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 20 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 21 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 22 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 23 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 24 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 25 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 26 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 27 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 28 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 29 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 30 | 2820735654 | Unclassified Bacteroidetes Th196P4bin9 | Isolate | Unclassified |
| 31 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 32 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 33 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 34 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 35 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 36 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 37 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 38 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 39 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 40 | 2820797595 | Unclassified Bacteroidetes Co191P3bin3 | Isolate | Unclassified |
| 41 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 42 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 43 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 44 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 45 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 46 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 47 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 48 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 49 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 50 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 51 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 52 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 53 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 54 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 55 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 56 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 57 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 58 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 59 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 60 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 61 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 62 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 63 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 64 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 65 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 66 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_317490 | 3300042612 | Unclassified | 2542 |
| 2 | Ga0466732_084813 | 3300042656 | Bacteria | 13233 |
| 3 | Ga0466706_057948 | 3300042599 | Bacteria | 28323 |
| 4 | Ga0466706_105288 | 3300042599 | Bacteria | 25776 |
| 5 | Ga0466706_261615 | 3300042599 | Bacteria | 4634 |
| 6 | Ga0466707_033583 | 3300042601 | Unclassified | 1749 |
| 7 | Ga0466716_249123 | 3300042605 | Unclassified | 1667 |
| 8 | Ga0466722_118978 | 3300042609 | Bacteria | 7673 |
| 9 | 2227602404 | 2225789004 | Bacteria | 12427 |
| 10 | JGI24702J35022_10001271 | 3300002462 | Bacteria | 15721 |
| 11 | JGI24702J35022_10008994 | 3300002462 | Unclassified | 5628 |
| 12 | JGI24702J35022_10020186 | 3300002462 | Bacteria | 3619 |
| 13 | JGI24702J35022_10023294 | 3300002462 | Unclassified | 3348 |
| 14 | JGI24702J35022_10095719 | 3300002462 | Unclassified | 1620 |
| 15 | Ga0265387_1028176 | 3300024582 | Bacteria | 892 |
| 16 | Ga0466694_044503 | 3300042594 | Bacteria | 1138 |
| 17 | Ga0466696_362417 | 3300042596 | Bacteria | 15301 |
| 18 | Ga0466710_257170 | 3300042613 | Bacteria | 1061 |
| 19 | Ga0466711_379518 | 3300042615 | Bacteria | 1065 |
| 20 | Ga0466728_138104 | 3300042620 | Bacteria | 1788 |
| 21 | Ga0466728_194438 | 3300042620 | Bacteria | 37048 |
| 22 | Ga0123357_10043906 | 3300009784 | Bacteria | 6070 |
| 23 | Ga0123353_10295367 | 3300010167 | Bacteria | 2477 |
| 24 | Ga0123353_10832264 | 3300010167 | Bacteria | 1269 |
| 25 | Ga0123354_10034281 | 3300010882 | Bacteria | 7939 |
| 26 | Ga0123354_10272507 | 3300010882 | Bacteria | 1662 |
| 27 | Ga0466731_237889 | 3300042622 | Bacteria | 2142 |
| 28 | Ga0466735_081134 | 3300042624 | Unclassified | 2929 |
| 29 | Ga0466708_368870 | 3300042652 | Bacteria | 8989 |
| 30 | Ga0466708_433246 | 3300042652 | Bacteria | 18152 |
| 31 | Ga0466725_443030 | 3300042654 | Bacteria | 4198 |
| 32 | Ga0466705_167517 | 3300042612 | Bacteria | 4002 |
| 33 | Ga0466706_087358 | 3300042599 | Bacteria | 18337 |
| 34 | Ga0466719_047184 | 3300042606 | Bacteria | 13746 |
| 35 | IMNBL1DRAFT_c0030560 | 3300000062 | Bacteria | 1973 |
| 36 | JGI24702J35022_10065424 | 3300002462 | Bacteria | 1950 |
| 37 | JGI24699J35502_11134032 | 3300002509 | Bacteria | 25745 |
| 38 | JGI24696J40584_12961276 | 3300002834 | Bacteria | 12945 |
| 39 | Ga0466696_241305 | 3300042596 | Bacteria | 1496 |
| 40 | Ga0466710_032496 | 3300042613 | Bacteria | 2728 |
| 41 | Ga0466726_174083 | 3300042619 | Bacteria | 3760 |
| 42 | Ga0466728_141273 | 3300042620 | Bacteria | 7423 |
| 43 | Ga0466728_247504 | 3300042620 | Unclassified | 4073 |
| 44 | Ga0123356_10897280 | 3300010049 | Bacteria | 1058 |
| 45 | Ga0123353_10385135 | 3300010167 | Unclassified | 2095 |
| 46 | Ga0123353_10640319 | 3300010167 | Bacteria | 1508 |
| 47 | Ga0123353_10688590 | 3300010167 | Bacteria | 1438 |
| 48 | Ga0123354_10054821 | 3300010882 | Bacteria | 5976 |
| 49 | Ga0123354_10231816 | 3300010882 | Unclassified | 1928 |
| 50 | Ga0466729_312744 | 3300042621 | Bacteria | 1422 |
| 51 | Ga0466731_201539 | 3300042622 | Unclassified | 1503 |
| 52 | Ga0466735_007616 | 3300042624 | Bacteria | 2662 |
| 53 | Ga0466735_125096 | 3300042624 | Bacteria | 2334 |
| 54 | Ga0466735_222836 | 3300042624 | Bacteria | 1529 |
| 55 | Ga0466703_171884 | 3300042636 | Unclassified | 2098 |
| 56 | Ga0466703_295154 | 3300042636 | Unclassified | 2154 |
| 57 | Ga0466704_193398 | 3300042643 | Unclassified | 8081 |
| 58 | Ga0466704_450750 | 3300042643 | Bacteria | 4571 |
| 59 | Ga0466697_181630 | 3300042611 | Bacteria | 38820 |
| 60 | Ga0466697_249298 | 3300042611 | Bacteria | 3551 |
| 61 | Ga0466705_125588 | 3300042612 | Bacteria | 27996 |
| 62 | Ga0466705_152547 | 3300042612 | Bacteria | 11580 |
| 63 | Ga0466733_189406 | 3300042659 | Bacteria | 1201 |
| 64 | Ga0466701_046864 | 3300042598 | Bacteria | 14511 |
| 65 | Ga0466706_032988 | 3300042599 | Bacteria | 10464 |
| 66 | Ga0466707_028681 | 3300042601 | Unclassified | 2603 |
| 67 | Ga0466707_257017 | 3300042601 | Bacteria | 9765 |
| 68 | Ga0466707_316571 | 3300042601 | Unclassified | 7199 |
| 69 | Ga0466717_123880 | 3300042604 | Unclassified | 1766 |
| 70 | Ga0466698_190947 | 3300042610 | Bacteria | 1250 |
| 71 | Ga0466698_287623 | 3300042610 | Bacteria | 1186 |
| 72 | JGI24698J34947_10162879 | 3300002449 | Unclassified | 911 |
| 73 | JGI24702J35022_10010087 | 3300002462 | Unclassified | 5291 |
| 74 | Ga0466690_120998 | 3300042590 | Bacteria | 13572 |
| 75 | Ga0466693_412419 | 3300042592 | Bacteria | 2265 |
| 76 | Ga0466710_052086 | 3300042613 | Bacteria | 1596 |
| 77 | Ga0466710_290234 | 3300042613 | Bacteria | 1291 |
| 78 | Ga0466723_075018 | 3300042618 | Bacteria | 14744 |
| 79 | Ga0466723_275984 | 3300042618 | Bacteria | 11133 |
| 80 | Ga0466726_384401 | 3300042619 | Bacteria | 4254 |
| 81 | Ga0123357_10306480 | 3300009784 | Bacteria | 1594 |
| 82 | Ga0123353_10138689 | 3300010167 | Bacteria | 3898 |
| 83 | Ga0123353_10737660 | 3300010167 | Bacteria | 1374 |
| 84 | Ga0466735_061350 | 3300042624 | Bacteria | 1907 |
| 85 | Ga0466725_338035 | 3300042654 | Bacteria | 1106 |
| 86 | Ga0466727_107090 | 3300042655 | Bacteria | 3899 |
| 87 | Ga0466727_243126 | 3300042655 | Bacteria | 9036 |
| 88 | Ga0466697_144685 | 3300042611 | Bacteria | 1098 |
| 89 | Ga0466705_130767 | 3300042612 | Unclassified | 2717 |
| 90 | Ga0466732_347634 | 3300042656 | Bacteria | 1069 |
| 91 | Ga0466733_158505 | 3300042659 | Bacteria | 36594 |
| 92 | Ga0466706_013291 | 3300042599 | Bacteria | 11018 |
| 93 | Ga0466706_118288 | 3300042599 | Bacteria | 10546 |
| 94 | Ga0466706_184542 | 3300042599 | Bacteria | 37298 |
| 95 | Ga0466721_010295 | 3300042608 | Bacteria | 2118 |
| 96 | IMNBL1DRAFT_c0002582 | 3300000062 | Bacteria | 12472 |
| 97 | IMNBL1DRAFT_c0043644 | 3300000062 | Bacteria | 1482 |
| 98 | JGI24702J35022_10022596 | 3300002462 | Bacteria | 3403 |
| 99 | Ga0068302_10009782 | 3300005071 | Bacteria | 6256 |
| 100 | Ga0466657_104396 | 3300042582 | Bacteria | 3119 |
| 101 | Ga0466693_002073 | 3300042592 | Bacteria | 3108 |
| 102 | Ga0466694_012187 | 3300042594 | Bacteria | 1091 |
| 103 | Ga0466710_278650 | 3300042613 | Bacteria | 1888 |
| 104 | Ga0466710_311014 | 3300042613 | Bacteria | 1014 |
| 105 | Ga0466711_152055 | 3300042615 | Bacteria | 9923 |
| 106 | Ga0466711_258558 | 3300042615 | Bacteria | 3894 |
| 107 | Ga0466726_251320 | 3300042619 | Unclassified | 4063 |
| 108 | Ga0123357_10004734 | 3300009784 | Bacteria | 16094 |
| 109 | Ga0123357_10005292 | 3300009784 | Bacteria | 15403 |
| 110 | Ga0123357_10240374 | 3300009784 | Unclassified | 1962 |
| 111 | Ga0123356_10362026 | 3300010049 | Bacteria | 1578 |
| 112 | Ga0123356_10427840 | 3300010049 | Bacteria | 1467 |
| 113 | Ga0123353_11374366 | 3300010167 | Bacteria | 910 |
| 114 | Ga0123354_10124490 | 3300010882 | Bacteria | 3303 |
| 115 | Ga0123354_10205350 | 3300010882 | Bacteria | 2150 |
| 116 | Ga0123354_10228834 | 3300010882 | Bacteria | 1950 |
| 117 | Ga0466735_159173 | 3300042624 | Unclassified | 3275 |
| 118 | Ga0466702_399972 | 3300042635 | Bacteria | 1035 |
| 119 | Ga0466703_223139 | 3300042636 | Bacteria | 8830 |
| 120 | Ga0466704_075713 | 3300042643 | Bacteria | 36071 |
| 121 | Ga0466727_249382 | 3300042655 | Bacteria | 4989 |
| 122 | Ga0466697_242666 | 3300042611 | Bacteria | 1662 |
| 123 | Ga0466701_085901 | 3300042598 | Unclassified | 4371 |
| 124 | Ga0466707_035133 | 3300042601 | Bacteria | 14568 |
| 125 | Ga0466717_250992 | 3300042604 | Bacteria | 1405 |
| 126 | Ga0466719_243030 | 3300042606 | Bacteria | 1027 |
| 127 | Ga0466722_210923 | 3300042609 | Bacteria | 3834 |
| 128 | Ga0466697_009007 | 3300042611 | Bacteria | 3177 |
| 129 | 2227008136 | 2225789003 | Bacteria | 27221 |
| 130 | 2227183566 | 2225789004 | Bacteria | 8043 |
| 131 | IMNBL1DRAFT_c0000203 | 3300000062 | Bacteria | 52380 |
| 132 | IMNBL1DRAFT_c0000593 | 3300000062 | Bacteria | 29136 |
| 133 | IMNBL1DRAFT_c0003162 | 3300000062 | Bacteria | 10817 |
| 134 | JGI24702J35022_10005447 | 3300002462 | Bacteria | 7432 |
| 135 | JGI24702J35022_10019347 | 3300002462 | Unclassified | 3704 |
| 136 | JGI24702J35022_10372828 | 3300002462 | Bacteria | 857 |
| 137 | JGI24696J40584_12831188 | 3300002834 | Bacteria | 931 |
| 138 | Ga0466690_215228 | 3300042590 | Bacteria | 16546 |
| 139 | Ga0466693_059192 | 3300042592 | Bacteria | 3649 |
| 140 | Ga0466691_020889 | 3300042593 | Bacteria | 16573 |
| 141 | Ga0466695_269825 | 3300042595 | Bacteria | 1869 |
| 142 | Ga0466710_359700 | 3300042613 | Bacteria | 4756 |
| 143 | Ga0466711_508225 | 3300042615 | Bacteria | 2847 |
| 144 | Ga0466723_034226 | 3300042618 | Bacteria | 7163 |
| 145 | Ga0466728_015135 | 3300042620 | Bacteria | 4019 |
| 146 | Ga0466728_159436 | 3300042620 | Bacteria | 8007 |
| 147 | Ga0123357_10187206 | 3300009784 | Unclassified | 2398 |
| 148 | Ga0123357_10342049 | 3300009784 | Unclassified | 1445 |
| 149 | Ga0123353_10036934 | 3300010167 | Bacteria | 7658 |
| 150 | Ga0123353_10072532 | 3300010167 | Bacteria | 5533 |
| 151 | Ga0123353_10330247 | 3300010167 | Bacteria | 2309 |
| 152 | Ga0123353_11198184 | 3300010167 | Unclassified | 997 |
| 153 | Ga0466735_008117 | 3300042624 | Bacteria | 3103 |
| 154 | Ga0466703_025338 | 3300042636 | Bacteria | 28922 |
| 155 | Ga0466703_079329 | 3300042636 | Unclassified | 7993 |
| 156 | Ga0466704_587918 | 3300042643 | Bacteria | 5414 |
| 157 | Ga0466697_267725 | 3300042611 | Bacteria | 2458 |
| 158 | Ga0466705_141908 | 3300042612 | Bacteria | 14178 |
| 159 | Ga0466733_196164 | 3300042659 | Bacteria | 24389 |
| 160 | Ga0466706_121228 | 3300042599 | Bacteria | 6695 |
| 161 | Ga0466717_250353 | 3300042604 | Bacteria | 1638 |
| 162 | Ga0466717_298338 | 3300042604 | Bacteria | 4064 |
| 163 | Ga0466716_544085 | 3300042605 | Bacteria | 17149 |
| 164 | Ga0466719_491698 | 3300042606 | Bacteria | 11130 |
| 165 | Ga0466720_141613 | 3300042607 | Bacteria | 1784 |
| 166 | Ga0466721_048595 | 3300042608 | Bacteria | 1076 |
| 167 | Ga0466697_038176 | 3300042611 | Bacteria | 1579 |
| 168 | 2227646820 | 2225789004 | Bacteria | 44193 |
| 169 | JGI24702J35022_10230539 | 3300002462 | Bacteria | 1071 |
| 170 | JGI24705J35276_12231532 | 3300002504 | Bacteria | 3973 |
| 171 | Ga0466696_377702 | 3300042596 | Bacteria | 6822 |
| 172 | Ga0466701_000700 | 3300042598 | Bacteria | 2339 |
| 173 | Ga0466710_260284 | 3300042613 | Bacteria | 1088 |
| 174 | Ga0466723_113056 | 3300042618 | Unclassified | 12668 |
| 175 | Ga0466726_079545 | 3300042619 | Bacteria | 1815 |
| 176 | Ga0123357_10009669 | 3300009784 | Bacteria | 12191 |
| 177 | Ga0123357_10385271 | 3300009784 | Unclassified | 1295 |
| 178 | Ga0123356_11365813 | 3300010049 | Bacteria | 870 |
| 179 | Ga0123354_10218335 | 3300010882 | Bacteria | 2035 |
| 180 | Ga0466734_164044 | 3300042623 | Bacteria | 1425 |
| 181 | Ga0466709_015483 | 3300042648 | Bacteria | 50381 |
| 182 | Ga0466709_408724 | 3300042648 | Bacteria | 7327 |
| 183 | Ga0466697_079868 | 3300042611 | Bacteria | 3290 |
| 184 | Ga0466733_124798 | 3300042659 | Bacteria | 13426 |
| 185 | Ga0466713_011290 | 3300042602 | Bacteria | 11850 |
| 186 | Ga0466698_050810 | 3300042610 | Bacteria | 1537 |
| 187 | Ga0466698_246858 | 3300042610 | Bacteria | 1199 |
| 188 | 2227200259 | 2225789004 | Bacteria | 7765 |
| 189 | JGI24702J35022_10063698 | 3300002462 | Unclassified | 1976 |
| 190 | JGI24702J35022_10293332 | 3300002462 | Bacteria | 958 |
| 191 | JGI24696J40584_12913010 | 3300002834 | Bacteria | 1272 |
| 192 | Ga0466657_165263 | 3300042582 | Unclassified | 1316 |
| 193 | Ga0466691_117488 | 3300042593 | Unclassified | 7654 |
| 194 | Ga0466694_203481 | 3300042594 | Bacteria | 2515 |
| 195 | Ga0466718_120295 | 3300042617 | Bacteria | 1431 |
| 196 | Ga0466723_354251 | 3300042618 | Bacteria | 2096 |
| 197 | Ga0466726_009770 | 3300042619 | Bacteria | 3961 |
| 198 | Ga0123356_10210487 | 3300010049 | Bacteria | 1993 |
| 199 | Ga0123356_10394375 | 3300010049 | Bacteria | 1520 |
| 200 | Ga0123356_10428482 | 3300010049 | Bacteria | 1467 |
| 201 | Ga0123353_10113205 | 3300010167 | Bacteria | 4368 |
| 202 | Ga0123353_10175808 | 3300010167 | Bacteria | 3394 |
| 203 | Ga0123353_10511629 | 3300010167 | Bacteria | 1745 |
| 204 | Ga0123353_10964587 | 3300010167 | Bacteria | 1151 |
| 205 | Ga0123354_10393978 | 3300010882 | Unclassified | 1180 |
| 206 | Ga0466703_408249 | 3300042636 | Unclassified | 4654 |
| 207 | Ga0466727_066108 | 3300042655 | Bacteria | 4124 |
| 208 | Ga0466727_235389 | 3300042655 | Bacteria | 27915 |
| 209 | Ga0466697_258576 | 3300042611 | Bacteria | 357278 |
| 210 | Ga0466706_238666 | 3300042599 | Bacteria | 2115 |
| 211 | Ga0466700_074495 | 3300042600 | Bacteria | 1587 |
| 212 | Ga0466707_039903 | 3300042601 | Bacteria | 24387 |
| 213 | Ga0466707_234578 | 3300042601 | Bacteria | 5937 |
| 214 | Ga0466707_282079 | 3300042601 | Bacteria | 3525 |
| 215 | Ga0466714_121423 | 3300042603 | Bacteria | 42550 |
| 216 | Ga0466719_008520 | 3300042606 | Bacteria | 4023 |
| 217 | Ga0466698_491281 | 3300042610 | Bacteria | 7203 |
| 218 | JGI24695J34938_10036826 | 3300002450 | Bacteria | 2227 |
| 219 | JGI24702J35022_10002511 | 3300002462 | Bacteria | 11201 |
| 220 | JGI24702J35022_10055312 | 3300002462 | Bacteria | 2117 |
| 221 | JGI24702J35022_10127959 | 3300002462 | Bacteria | 1408 |
| 222 | JGI24702J35022_10151973 | 3300002462 | Bacteria | 1299 |
| 223 | Ga0466690_247455 | 3300042590 | Unclassified | 5437 |
| 224 | Ga0466693_348481 | 3300042592 | Bacteria | 2368 |
| 225 | Ga0466693_384843 | 3300042592 | Bacteria | 1531 |
| 226 | Ga0466694_000220 | 3300042594 | Bacteria | 2671 |
| 227 | Ga0466695_085933 | 3300042595 | Bacteria | 1987 |
| 228 | Ga0466711_064691 | 3300042615 | Bacteria | 7824 |
| 229 | Ga0123357_10259245 | 3300009784 | Bacteria | 1842 |
| 230 | Ga0123357_10304565 | 3300009784 | Unclassified | 1603 |
| 231 | Ga0123357_10325784 | 3300009784 | Unclassified | 1510 |
| 232 | Ga0123353_10958332 | 3300010167 | Bacteria | 1156 |
| 233 | Ga0123354_10043245 | 3300010882 | Bacteria | 6928 |
| 234 | Ga0466731_156687 | 3300042622 | Bacteria | 1544 |
| 235 | Ga0466734_090823 | 3300042623 | Bacteria | 3178 |
| 236 | Ga0466735_075931 | 3300042624 | Bacteria | 1512 |
| 237 | Ga0466703_158987 | 3300042636 | Bacteria | 11731 |
| 238 | Ga0466709_207253 | 3300042648 | Unclassified | 1672 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00005 | ABC_tran | ABC transporter | 65 | 213 | 0.95 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.