Protein Family IF03444
Metagenome
Isolate
172
Members
50
Samples
167
Scaffolds
440.94
Avg Length
Representative Sequence
- ID
- 3300010882|Ga0123354_10000042|Ga0123354_1000004243
- Length
- 424 aa
- Sequence
- MSRIIVDFNKVFGFVSEQQIFDRAERAESANIELENGTGKGSDFLGWLHLPSSTMEAGLNEVLETADELRARCEVVVIIGIGGSYLGARAVIDALSGSFDGLSNKKPVIVYAGHQIGEDYLHELTEYLTGKSFGIINISKSGTTTEPALAFRLLKKQLENAVGIDEARKRIIAITDRERGALRTLATRERYKTFVIPDDVGGRFSVLTLVGLLPIAVAGIDIQQLIAGAVEMEKATGTTVPFAKNPAAMYAVVRNELYLQGKKMEILANFNSKLHYVGEWWKQLFGESEGKENKGIFPAAVDIQEGERTIFETVLSVAQSRYTVEVPEDKADLDGLNYLAGKRVDYVNKMAELGTQQAHVAGGVPNIRIEIPELNEYCLGQLLYFFERACAISGYLLGVNPFDQPGVEAYKNNMFALLKKPGS*
Sample Types
Isolate
2.9%
Metagenome
97.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
36.7%
Kalotermitidae
28.6%
Unclassified
12.2%
Rhinotermitidae
8.2%
Termopsidae
6.1%
Passalidae
4.1%
Hodotermitidae
2.0%
Blattidae
2.0%
Taxonomy
Archaea
0
Bacteria
169
Eukaryota
0
Viruses
0
Unclassified
3
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 2 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 3 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 4 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 5 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 6 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 7 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 8 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 9 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 10 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 11 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 12 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 13 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 14 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 15 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 16 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 17 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 18 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 19 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 20 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 21 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 22 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 23 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 24 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 25 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 26 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 27 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 28 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 29 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 30 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 31 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 32 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 33 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 34 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 35 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 36 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 37 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 38 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 39 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 40 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 41 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 42 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 43 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 44 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 45 | 643348524 | Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 | Isolate | Unclassified |
| 46 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 47 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 48 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 49 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 50 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123354_10003084 | 3300010882 | Bacteria | 22749 |
| 2 | Ga0466701_052708 | 3300042598 | Bacteria | 25914 |
| 3 | Ga0466713_077436 | 3300042602 | Bacteria | 22165 |
| 4 | Ga0466713_077669 | 3300042602 | Bacteria | 61043 |
| 5 | Ga0466722_194750 | 3300042609 | Bacteria | 1759 |
| 6 | Ga0466705_395852 | 3300042612 | Bacteria | 5761 |
| 7 | Ga0466705_460214 | 3300042612 | Bacteria | 4146 |
| 8 | Ga0466711_155555 | 3300042615 | Bacteria | 4619 |
| 9 | Ga0466723_113260 | 3300042618 | Bacteria | 45589 |
| 10 | Ga0466726_344729 | 3300042619 | Bacteria | 4000 |
| 11 | Ga0466690_100077 | 3300042590 | Bacteria | 8481 |
| 12 | Ga0466704_283999 | 3300042643 | Bacteria | 25730 |
| 13 | Ga0466709_076850 | 3300042648 | Bacteria | 50213 |
| 14 | Ga0466709_223600 | 3300042648 | Bacteria | 9989 |
| 15 | Ga0466727_119437 | 3300042655 | Bacteria | 3624 |
| 16 | 2227403034 | 2225789004 | Bacteria | 5762 |
| 17 | JGI24702J35022_10002702 | 3300002462 | Bacteria | 10763 |
| 18 | JGI24705J35276_12221522 | 3300002504 | Bacteria | 2348 |
| 19 | JGI24699J35502_11134154 | 3300002509 | Bacteria | 38326 |
| 20 | Ga0123357_10001158 | 3300009784 | Bacteria | 27473 |
| 21 | Ga0466733_150986 | 3300042659 | Unclassified | 4299 |
| 22 | Ga0123353_10046986 | 3300010167 | Bacteria | 6863 |
| 23 | Ga0123354_10000042 | 3300010882 | Bacteria | 95103 |
| 24 | Ga0466706_142882 | 3300042599 | Bacteria | 78904 |
| 25 | Ga0466707_063004 | 3300042601 | Bacteria | 15160 |
| 26 | Ga0466707_135985 | 3300042601 | Bacteria | 9923 |
| 27 | Ga0466713_102957 | 3300042602 | Bacteria | 7684 |
| 28 | Ga0466714_155104 | 3300042603 | Bacteria | 5063 |
| 29 | Ga0466719_095502 | 3300042606 | Bacteria | 4988 |
| 30 | Ga0466719_176141 | 3300042606 | Bacteria | 20840 |
| 31 | Ga0466719_344761 | 3300042606 | Bacteria | 8775 |
| 32 | Ga0466722_257304 | 3300042609 | Bacteria | 3941 |
| 33 | Ga0466715_016119 | 3300042616 | Bacteria | 2246 |
| 34 | Ga0466715_274705 | 3300042616 | Bacteria | 6072 |
| 35 | Ga0466723_027644 | 3300042618 | Bacteria | 14041 |
| 36 | Ga0466723_083949 | 3300042618 | Bacteria | 18458 |
| 37 | Ga0466723_318795 | 3300042618 | Bacteria | 24156 |
| 38 | Ga0466728_082257 | 3300042620 | Bacteria | 106309 |
| 39 | Ga0466690_004552 | 3300042590 | Bacteria | 6148 |
| 40 | Ga0466690_046251 | 3300042590 | Bacteria | 8970 |
| 41 | Ga0466691_133902 | 3300042593 | Bacteria | 22965 |
| 42 | Ga0466729_212660 | 3300042621 | Bacteria | 2366 |
| 43 | Ga0466703_073365 | 3300042636 | Bacteria | 4727 |
| 44 | Ga0466704_568650 | 3300042643 | Bacteria | 15350 |
| 45 | Ga0466708_334452 | 3300042652 | Bacteria | 8300 |
| 46 | Ga0466705_108901 | 3300042612 | Bacteria | 9778 |
| 47 | Ga0123354_10004553 | 3300010882 | Bacteria | 19666 |
| 48 | Ga0123354_10037989 | 3300010882 | Bacteria | 7482 |
| 49 | Ga0466706_015749 | 3300042599 | Bacteria | 23160 |
| 50 | Ga0466707_026105 | 3300042601 | Bacteria | 2745 |
| 51 | Ga0466707_221100 | 3300042601 | Bacteria | 5235 |
| 52 | Ga0466714_084201 | 3300042603 | Bacteria | 1571 |
| 53 | Ga0466719_016366 | 3300042606 | Bacteria | 2665 |
| 54 | Ga0466722_184008 | 3300042609 | Bacteria | 25711 |
| 55 | Ga0466710_354966 | 3300042613 | Bacteria | 1858 |
| 56 | Ga0466711_051038 | 3300042615 | Bacteria | 19046 |
| 57 | Ga0466711_275090 | 3300042615 | Bacteria | 26757 |
| 58 | Ga0466726_146641 | 3300042619 | Bacteria | 10357 |
| 59 | Ga0466729_134083 | 3300042621 | Bacteria | 2961 |
| 60 | Ga0466692_113976 | 3300042591 | Bacteria | 14367 |
| 61 | Ga0466691_032806 | 3300042593 | Bacteria | 1619 |
| 62 | Ga0466735_094639 | 3300042624 | Bacteria | 4379 |
| 63 | Ga0466735_234997 | 3300042624 | Bacteria | 6166 |
| 64 | Ga0466703_075593 | 3300042636 | Bacteria | 5222 |
| 65 | JGI24705J35276_12236490 | 3300002504 | Bacteria | 8183 |
| 66 | Ga0466705_164201 | 3300042612 | Bacteria | 2962 |
| 67 | Ga0123357_10003901 | 3300009784 | Bacteria | 17309 |
| 68 | Ga0123357_10010080 | 3300009784 | Bacteria | 11986 |
| 69 | Ga0123357_10064000 | 3300009784 | Unclassified | 4917 |
| 70 | Ga0123357_10117385 | 3300009784 | Bacteria | 3366 |
| 71 | Ga0123356_10044868 | 3300010049 | Bacteria | 4114 |
| 72 | Ga0123354_10002434 | 3300010882 | Bacteria | 24588 |
| 73 | Ga0466719_266385 | 3300042606 | Bacteria | 2231 |
| 74 | Ga0466722_035543 | 3300042609 | Bacteria | 116913 |
| 75 | Ga0466722_090744 | 3300042609 | Bacteria | 26452 |
| 76 | Ga0466715_165271 | 3300042616 | Bacteria | 2692 |
| 77 | Ga0456237_0000003 | 3300041968 | Bacteria | 82299 |
| 78 | Ga0466692_167919 | 3300042591 | Bacteria | 2540 |
| 79 | Ga0466691_023288 | 3300042593 | Bacteria | 1649 |
| 80 | Ga0466696_363248 | 3300042596 | Bacteria | 7847 |
| 81 | Ga0466703_416209 | 3300042636 | Bacteria | 1814 |
| 82 | Ga0466703_416796 | 3300042636 | Bacteria | 12962 |
| 83 | IMNBL1DRAFT_c0001556 | 3300000062 | Bacteria | 17073 |
| 84 | IMNBL1DRAFT_c0014079 | 3300000062 | Bacteria | 3553 |
| 85 | JGI24699J35502_11133987 | 3300002509 | Bacteria | 22805 |
| 86 | Ga0123357_10029046 | 3300009784 | Bacteria | 7495 |
| 87 | Ga0123357_10118262 | 3300009784 | Bacteria | 3350 |
| 88 | Ga0466706_242325 | 3300042599 | Bacteria | 5121 |
| 89 | Ga0466700_257615 | 3300042600 | Bacteria | 7856 |
| 90 | Ga0466707_075198 | 3300042601 | Bacteria | 13033 |
| 91 | Ga0466713_040847 | 3300042602 | Bacteria | 12526 |
| 92 | Ga0466714_148664 | 3300042603 | Bacteria | 2504 |
| 93 | Ga0466714_157225 | 3300042603 | Bacteria | 12577 |
| 94 | Ga0466716_025263 | 3300042605 | Bacteria | 7895 |
| 95 | Ga0466716_415709 | 3300042605 | Bacteria | 17767 |
| 96 | Ga0466722_097757 | 3300042609 | Bacteria | 5004 |
| 97 | Ga0466722_122978 | 3300042609 | Bacteria | 2564 |
| 98 | Ga0466698_304711 | 3300042610 | Bacteria | 1902 |
| 99 | Ga0466728_034686 | 3300042620 | Bacteria | 6820 |
| 100 | Ga0466692_027305 | 3300042591 | Bacteria | 7885 |
| 101 | Ga0466725_078911 | 3300042654 | Bacteria | 22676 |
| 102 | Ga0466727_098929 | 3300042655 | Bacteria | 2855 |
| 103 | 2227578523 | 2225789004 | Unclassified | 2535 |
| 104 | IMNBL1DRAFT_c0000303 | 3300000062 | Bacteria | 41914 |
| 105 | JGI24699J35502_11134073 | 3300002509 | Bacteria | 28326 |
| 106 | Ga0123357_10001146 | 3300009784 | Bacteria | 27559 |
| 107 | Ga0123357_10006419 | 3300009784 | Bacteria | 14343 |
| 108 | Ga0123356_10096010 | 3300010049 | Bacteria | 2834 |
| 109 | Ga0466713_049733 | 3300042602 | Bacteria | 2829 |
| 110 | Ga0466713_071386 | 3300042602 | Bacteria | 40802 |
| 111 | Ga0466716_276433 | 3300042605 | Bacteria | 12747 |
| 112 | Ga0466715_317199 | 3300042616 | Bacteria | 12833 |
| 113 | Ga0466715_372014 | 3300042616 | Bacteria | 24656 |
| 114 | Ga0466723_043699 | 3300042618 | Bacteria | 2743 |
| 115 | Ga0466690_039144 | 3300042590 | Bacteria | 6565 |
| 116 | Ga0466690_165220 | 3300042590 | Bacteria | 1889 |
| 117 | Ga0466690_262488 | 3300042590 | Bacteria | 4855 |
| 118 | Ga0466695_265771 | 3300042595 | Bacteria | 4950 |
| 119 | Ga0466696_323034 | 3300042596 | Bacteria | 3448 |
| 120 | Ga0466704_243318 | 3300042643 | Bacteria | 32973 |
| 121 | Ga0466708_073591 | 3300042652 | Bacteria | 6339 |
| 122 | IMNBL1DRAFT_c0000345 | 3300000062 | Bacteria | 39398 |
| 123 | JGI24705J35276_12233952 | 3300002504 | Bacteria | 5158 |
| 124 | Ga0123357_10000419 | 3300009784 | Bacteria | 40548 |
| 125 | Ga0466705_316488 | 3300042612 | Bacteria | 1799 |
| 126 | Ga0466733_019356 | 3300042659 | Bacteria | 61537 |
| 127 | Ga0123357_10204752 | 3300009784 | Bacteria | 2235 |
| 128 | Ga0123356_10036045 | 3300010049 | Bacteria | 4619 |
| 129 | Ga0466698_443351 | 3300042610 | Bacteria | 1742 |
| 130 | Ga0466697_013266 | 3300042611 | Bacteria | 1895 |
| 131 | Ga0466710_067859 | 3300042613 | Bacteria | 1521 |
| 132 | Ga0466723_029341 | 3300042618 | Bacteria | 7756 |
| 133 | Ga0264413_149562 | 3300024493 | Bacteria | 3168 |
| 134 | Ga0466690_241027 | 3300042590 | Bacteria | 13320 |
| 135 | Ga0466690_341355 | 3300042590 | Bacteria | 23370 |
| 136 | Ga0466691_195596 | 3300042593 | Bacteria | 68522 |
| 137 | Ga0466696_344053 | 3300042596 | Bacteria | 20178 |
| 138 | Ga0466735_013107 | 3300042624 | Bacteria | 3896 |
| 139 | Ga0466704_256082 | 3300042643 | Bacteria | 3552 |
| 140 | Ga0466704_445869 | 3300042643 | Bacteria | 10104 |
| 141 | Ga0466709_407672 | 3300042648 | Bacteria | 84536 |
| 142 | JGI24699J35502_11134225 | 3300002509 | Bacteria | 74107 |
| 143 | Ga0466705_223226 | 3300042612 | Bacteria | 4215 |
| 144 | Ga0466733_154955 | 3300042659 | Bacteria | 10677 |
| 145 | Ga0466700_057887 | 3300042600 | Bacteria | 2800 |
| 146 | Ga0466700_276650 | 3300042600 | Bacteria | 9365 |
| 147 | Ga0466707_121228 | 3300042601 | Bacteria | 26661 |
| 148 | Ga0466713_098111 | 3300042602 | Bacteria | 9321 |
| 149 | Ga0466717_210207 | 3300042604 | Bacteria | 5538 |
| 150 | Ga0466719_114028 | 3300042606 | Bacteria | 2627 |
| 151 | Ga0466722_073992 | 3300042609 | Bacteria | 7758 |
| 152 | Ga0466715_079087 | 3300042616 | Bacteria | 12214 |
| 153 | Ga0466715_314614 | 3300042616 | Bacteria | 16526 |
| 154 | Ga0466723_227268 | 3300042618 | Bacteria | 8623 |
| 155 | Ga0466723_326767 | 3300042618 | Bacteria | 7130 |
| 156 | Ga0466726_228066 | 3300042619 | Bacteria | 10586 |
| 157 | Ga0466728_202574 | 3300042620 | Bacteria | 4984 |
| 158 | Ga0466692_014618 | 3300042591 | Bacteria | 107882 |
| 159 | Ga0466696_094699 | 3300042596 | Bacteria | 13208 |
| 160 | Ga0466729_265332 | 3300042621 | Bacteria | 5556 |
| 161 | Ga0466731_116772 | 3300042622 | Bacteria | 3810 |
| 162 | Ga0466703_113183 | 3300042636 | Bacteria | 4402 |
| 163 | Ga0466703_262133 | 3300042636 | Bacteria | 48736 |
| 164 | Ga0466704_472212 | 3300042643 | Bacteria | 2972 |
| 165 | Ga0466727_132693 | 3300042655 | Bacteria | 19237 |
| 166 | Ga0466727_144655 | 3300042655 | Bacteria | 5084 |
| 167 | JGI24702J35022_10001513 | 3300002462 | Bacteria | 14438 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00342 | PGI | Phosphoglucose isomerase | 360 | 412 | 0.85 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.