Protein Family IF03426
Metagenome
Isolate
255
Members
74
Samples
232
Scaffolds
84.28
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_12697105|Ga0123353_126971052
- Length
- 80 aa
- Sequence
- MANHKSAVKRIRQTLTRRLRNKYYAKTTRNAVRDLKAAASELYKKVSAMLDKLAKKNVIHKNKAGNLKSKLALHVNKLN*
Sample Types
Isolate
9.0%
Metagenome
91.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
27.1%
Kalotermitidae
20.0%
Blattidae
17.1%
Unclassified
12.9%
Rhinotermitidae
7.1%
Termopsidae
5.7%
Passalidae
4.3%
Hydrophilidae
2.9%
Hodotermitidae
1.4%
Tenebrionidae
1.4%
Taxonomy
Archaea
0
Bacteria
218
Eukaryota
0
Viruses
0
Unclassified
37
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 2 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 3 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 4 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 5 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 6 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 7 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 8 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 9 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 10 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 11 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 12 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 13 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 14 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 15 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 16 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 17 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 18 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 19 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 20 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 21 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 22 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 23 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 24 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 25 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 26 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 27 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 28 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 29 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 30 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 31 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 32 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 33 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 34 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 35 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 36 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 37 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 38 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 39 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 40 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 41 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 42 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 43 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 44 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 45 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 46 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 47 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 48 | 2718218155 | Flavobacteriaceae bacterium UJ101 | Isolate | |
| 49 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 50 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 51 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 52 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 53 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 54 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 55 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 56 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 57 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 58 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 59 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 60 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 61 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 62 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 63 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 64 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 65 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 66 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 67 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 68 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 69 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 70 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 71 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 72 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 73 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 74 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466729_223186 | 3300042621 | Bacteria | 2534 |
| 2 | Ga0466735_162053 | 3300042624 | Bacteria | 1419 |
| 3 | Ga0466703_045661 | 3300042636 | Bacteria | 1031 |
| 4 | Ga0466708_119090 | 3300042652 | Bacteria | 8039 |
| 5 | Ga0466708_203599 | 3300042652 | Bacteria | 24919 |
| 6 | Ga0466727_233507 | 3300042655 | Bacteria | 20444 |
| 7 | IMNBL1DRAFT_c0004169 | 3300000062 | Bacteria | 8790 |
| 8 | IMNBL1DRAFT_c0043245 | 3300000062 | Bacteria | 1493 |
| 9 | IMNBL1DRAFT_c0195140 | 3300000062 | Bacteria | 509 |
| 10 | JGI24702J35022_10033719 | 3300002462 | Bacteria | 2738 |
| 11 | JGI24702J35022_10081628 | 3300002462 | Bacteria | 1752 |
| 12 | JGI24702J35022_10799069 | 3300002462 | Bacteria | 588 |
| 13 | JGI24702J35022_10861479 | 3300002462 | Bacteria | 564 |
| 14 | Ga0068302_10164450 | 3300005071 | Unclassified | 1234 |
| 15 | Ga0123357_10001576 | 3300009784 | Bacteria | 24363 |
| 16 | Ga0466711_243807 | 3300042615 | Unclassified | 1288 |
| 17 | Ga0466723_107339 | 3300042618 | Unclassified | 9664 |
| 18 | Ga0466726_421046 | 3300042619 | Bacteria | 15138 |
| 19 | Ga0466729_126291 | 3300042621 | Bacteria | 3881 |
| 20 | Ga0466692_196455 | 3300042591 | Bacteria | 23185 |
| 21 | Ga0466700_151225 | 3300042600 | Unclassified | 2864 |
| 22 | Ga0466707_049988 | 3300042601 | Bacteria | 15896 |
| 23 | Ga0466707_265538 | 3300042601 | Bacteria | 3236 |
| 24 | Ga0466707_406616 | 3300042601 | Bacteria | 1610 |
| 25 | Ga0466713_142200 | 3300042602 | Bacteria | 3662 |
| 26 | Ga0466719_154997 | 3300042606 | Unclassified | 1118 |
| 27 | Ga0466719_234734 | 3300042606 | Bacteria | 1440 |
| 28 | Ga0123356_10229298 | 3300010049 | Bacteria | 1920 |
| 29 | Ga0123356_10329344 | 3300010049 | Bacteria | 1643 |
| 30 | Ga0123356_13074362 | 3300010049 | Bacteria | 582 |
| 31 | Ga0123353_10685658 | 3300010167 | Unclassified | 1442 |
| 32 | Ga0123353_11533065 | 3300010167 | Bacteria | 846 |
| 33 | Ga0123354_11078830 | 3300010882 | Unclassified | 511 |
| 34 | Ga0466705_197975 | 3300042612 | Bacteria | 1471 |
| 35 | Ga0466732_183715 | 3300042656 | Bacteria | 1288 |
| 36 | Ga0466732_389154 | 3300042656 | Bacteria | 37066 |
| 37 | Ga0466733_033275 | 3300042659 | Bacteria | 24290 |
| 38 | Ga0466733_126074 | 3300042659 | Bacteria | 22337 |
| 39 | Ga0466735_092085 | 3300042624 | Bacteria | 9274 |
| 40 | Ga0466735_170282 | 3300042624 | Bacteria | 7133 |
| 41 | Ga0466735_220219 | 3300042624 | Unclassified | 1128 |
| 42 | Ga0466703_058273 | 3300042636 | Bacteria | 1463 |
| 43 | Ga0466704_108742 | 3300042643 | Bacteria | 5580 |
| 44 | Ga0466704_310676 | 3300042643 | Unclassified | 3518 |
| 45 | Ga0466727_078946 | 3300042655 | Unclassified | 10147 |
| 46 | 2227515964 | 2225789004 | Bacteria | 681 |
| 47 | Ga0068305_10818887 | 3300005083 | Bacteria | 1879 |
| 48 | Ga0466710_077987 | 3300042613 | Bacteria | 1007 |
| 49 | Ga0466715_435671 | 3300042616 | Bacteria | 16861 |
| 50 | Ga0466715_497593 | 3300042616 | Bacteria | 37962 |
| 51 | Ga0466723_326692 | 3300042618 | Bacteria | 8550 |
| 52 | Ga0466690_139910 | 3300042590 | Bacteria | 15432 |
| 53 | Ga0466700_070473 | 3300042600 | Bacteria | 11388 |
| 54 | Ga0466707_048206 | 3300042601 | Bacteria | 20502 |
| 55 | Ga0466713_099183 | 3300042602 | Bacteria | 118109 |
| 56 | Ga0123357_10568769 | 3300009784 | Bacteria | 891 |
| 57 | Ga0123357_10826271 | 3300009784 | Unclassified | 619 |
| 58 | Ga0123354_10147964 | 3300010882 | Bacteria | 2863 |
| 59 | Ga0123354_10341530 | 3300010882 | Bacteria | 1349 |
| 60 | Ga0123354_10440582 | 3300010882 | Unclassified | 1064 |
| 61 | Ga0123354_11001980 | 3300010882 | Bacteria | 537 |
| 62 | Ga0466697_165266 | 3300042611 | Bacteria | 2058 |
| 63 | Ga0466705_038327 | 3300042612 | Bacteria | 16548 |
| 64 | Ga0466733_153348 | 3300042659 | Unclassified | 3042 |
| 65 | Ga0466733_157076 | 3300042659 | Bacteria | 1592 |
| 66 | Ga0466729_262668 | 3300042621 | Bacteria | 5488 |
| 67 | Ga0466735_141804 | 3300042624 | Bacteria | 6419 |
| 68 | Ga0466735_143086 | 3300042624 | Bacteria | 1663 |
| 69 | Ga0466730_074222 | 3300042625 | Unclassified | 1525 |
| 70 | Ga0466703_033638 | 3300042636 | Bacteria | 2369 |
| 71 | Ga0466703_045193 | 3300042636 | Bacteria | 1569 |
| 72 | Ga0466709_159448 | 3300042648 | Bacteria | 14626 |
| 73 | Ga0466727_346854 | 3300042655 | Unclassified | 1428 |
| 74 | 2227072523 | 2225789003 | Bacteria | 535 |
| 75 | 2227075804 | 2225789003 | Unclassified | 2265 |
| 76 | 2227275255 | 2225789004 | Bacteria | 6858 |
| 77 | IMNBL1DRAFT_c0001284 | 3300000062 | Bacteria | 18924 |
| 78 | IMNBL1DRAFT_c0003096 | 3300000062 | Bacteria | 10971 |
| 79 | IMNBL1DRAFT_c0004346 | 3300000062 | Bacteria | 8563 |
| 80 | IMNBL1DRAFT_c0006150 | 3300000062 | Bacteria | 6635 |
| 81 | IMNBL1DRAFT_c0134596 | 3300000062 | Unclassified | 641 |
| 82 | IMNBL1DRAFT_c0143434 | 3300000062 | Bacteria | 616 |
| 83 | JGI24702J35022_10004286 | 3300002462 | Bacteria | 8509 |
| 84 | Ga0068305_10000551 | 3300005083 | Bacteria | 1881 |
| 85 | Ga0466711_005720 | 3300042615 | Bacteria | 2209 |
| 86 | Ga0466696_362272 | 3300042596 | Bacteria | 1581 |
| 87 | Ga0466713_003545 | 3300042602 | Bacteria | 9232 |
| 88 | Ga0466713_024656 | 3300042602 | Bacteria | 1233 |
| 89 | Ga0466722_143687 | 3300042609 | Bacteria | 15059 |
| 90 | Ga0466698_086129 | 3300042610 | Unclassified | 1480 |
| 91 | Ga0123357_10478527 | 3300009784 | Bacteria | 1054 |
| 92 | Ga0123356_11768811 | 3300010049 | Bacteria | 768 |
| 93 | Ga0123353_10312686 | 3300010167 | Bacteria | 2389 |
| 94 | Ga0123354_10054498 | 3300010882 | Bacteria | 5999 |
| 95 | Ga0123354_10483269 | 3300010882 | Bacteria | 978 |
| 96 | Ga0466705_050286 | 3300042612 | Bacteria | 4038 |
| 97 | Ga0466733_212740 | 3300042659 | Unclassified | 5248 |
| 98 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 99 | Ga0466735_035667 | 3300042624 | Bacteria | 2764 |
| 100 | Ga0466703_034601 | 3300042636 | Bacteria | 4713 |
| 101 | Ga0466703_036019 | 3300042636 | Bacteria | 12615 |
| 102 | Ga0466703_154723 | 3300042636 | Bacteria | 2270 |
| 103 | Ga0466704_020207 | 3300042643 | Bacteria | 1792 |
| 104 | Ga0466704_486400 | 3300042643 | Bacteria | 18140 |
| 105 | Ga0466709_117757 | 3300042648 | Bacteria | 10700 |
| 106 | 2227008145 | 2225789003 | Bacteria | 23710 |
| 107 | 2227631297 | 2225789004 | Unclassified | 2121 |
| 108 | IMNBL1DRAFT_c0001423 | 3300000062 | Bacteria | 17909 |
| 109 | JGI24705J35276_12231987 | 3300002504 | Bacteria | 4137 |
| 110 | JGI24696J40584_12426134 | 3300002834 | Bacteria | 565 |
| 111 | Ga0123357_10000751 | 3300009784 | Bacteria | 32682 |
| 112 | Ga0466715_137716 | 3300042616 | Unclassified | 1057 |
| 113 | Ga0466723_101754 | 3300042618 | Bacteria | 10500 |
| 114 | Ga0466726_138112 | 3300042619 | Bacteria | 1860 |
| 115 | Ga0466726_143525 | 3300042619 | Bacteria | 15761 |
| 116 | Ga0466690_405574 | 3300042590 | Bacteria | 2312 |
| 117 | Ga0466692_034223 | 3300042591 | Bacteria | 54843 |
| 118 | Ga0466691_081401 | 3300042593 | Bacteria | 70057 |
| 119 | Ga0466700_338783 | 3300042600 | Bacteria | 5679 |
| 120 | Ga0466707_057199 | 3300042601 | Bacteria | 6997 |
| 121 | Ga0466707_399872 | 3300042601 | Bacteria | 25092 |
| 122 | Ga0466707_405284 | 3300042601 | Bacteria | 5767 |
| 123 | Ga0466713_060620 | 3300042602 | Bacteria | 398690 |
| 124 | Ga0466713_109231 | 3300042602 | Bacteria | 188899 |
| 125 | Ga0466714_166694 | 3300042603 | Bacteria | 5403 |
| 126 | Ga0466719_445650 | 3300042606 | Bacteria | 3956 |
| 127 | Ga0123356_11276132 | 3300010049 | Bacteria | 898 |
| 128 | Ga0123353_12688701 | 3300010167 | Bacteria | 586 |
| 129 | Ga0466734_031235 | 3300042623 | Bacteria | 8095 |
| 130 | Ga0466735_196672 | 3300042624 | Bacteria | 1189 |
| 131 | Ga0466730_094306 | 3300042625 | Bacteria | 1593 |
| 132 | Ga0466704_076477 | 3300042643 | Bacteria | 3120 |
| 133 | IMNBL1DRAFT_c0015679 | 3300000062 | Bacteria | 3280 |
| 134 | Ga0466711_041895 | 3300042615 | Bacteria | 1653 |
| 135 | Ga0466711_336598 | 3300042615 | Unclassified | 14218 |
| 136 | Ga0466726_041369 | 3300042619 | Bacteria | 6812 |
| 137 | Ga0466726_114053 | 3300042619 | Bacteria | 7498 |
| 138 | Ga0466728_092133 | 3300042620 | Unclassified | 12009 |
| 139 | Ga0466728_318807 | 3300042620 | Bacteria | 17284 |
| 140 | Ga0466729_123171 | 3300042621 | Bacteria | 3490 |
| 141 | Ga0466690_046033 | 3300042590 | Unclassified | 1903 |
| 142 | Ga0466690_220107 | 3300042590 | Unclassified | 5338 |
| 143 | Ga0466696_383499 | 3300042596 | Bacteria | 1122 |
| 144 | Ga0466701_038964 | 3300042598 | Bacteria | 1494 |
| 145 | Ga0466707_170516 | 3300042601 | Bacteria | 13967 |
| 146 | Ga0466707_337609 | 3300042601 | Bacteria | 5314 |
| 147 | Ga0466713_107644 | 3300042602 | Bacteria | 8490 |
| 148 | Ga0466719_428564 | 3300042606 | Bacteria | 11764 |
| 149 | Ga0466722_073972 | 3300042609 | Bacteria | 128406 |
| 150 | Ga0123357_10309158 | 3300009784 | Unclassified | 1582 |
| 151 | Ga0123356_10085714 | 3300010049 | Bacteria | 2989 |
| 152 | Ga0123353_12697105 | 3300010167 | Bacteria | 585 |
| 153 | Ga0466705_303703 | 3300042612 | Bacteria | 5594 |
| 154 | Ga0466729_239498 | 3300042621 | Bacteria | 3112 |
| 155 | Ga0466735_116003 | 3300042624 | Bacteria | 3440 |
| 156 | Ga0466730_018513 | 3300042625 | Unclassified | 1332 |
| 157 | 2227652412 | 2225789004 | Bacteria | 10723 |
| 158 | IMNBL1DRAFT_c0016160 | 3300000062 | Bacteria | 3207 |
| 159 | JGI24702J35022_10073657 | 3300002462 | Bacteria | 1842 |
| 160 | Ga0072941_1211583 | 3300005201 | Bacteria | 1482 |
| 161 | Ga0466711_184022 | 3300042615 | Bacteria | 3978 |
| 162 | Ga0466711_514177 | 3300042615 | Unclassified | 3659 |
| 163 | Ga0466715_643621 | 3300042616 | Bacteria | 17654 |
| 164 | Ga0466729_190578 | 3300042621 | Bacteria | 11255 |
| 165 | Ga0466690_397462 | 3300042590 | Bacteria | 21006 |
| 166 | Ga0466692_205037 | 3300042591 | Bacteria | 4929 |
| 167 | Ga0466701_074121 | 3300042598 | Bacteria | 11299 |
| 168 | Ga0466707_415828 | 3300042601 | Bacteria | 4714 |
| 169 | Ga0466713_052713 | 3300042602 | Bacteria | 5576 |
| 170 | Ga0466716_360599 | 3300042605 | Unclassified | 4181 |
| 171 | Ga0466719_172678 | 3300042606 | Bacteria | 3985 |
| 172 | Ga0466719_469471 | 3300042606 | Unclassified | 7908 |
| 173 | Ga0123353_10659944 | 3300010167 | Bacteria | 1478 |
| 174 | Ga0123353_11867342 | 3300010167 | Bacteria | 743 |
| 175 | Ga0466732_200957 | 3300042656 | Bacteria | 4768 |
| 176 | Ga0466733_084365 | 3300042659 | Bacteria | 13107 |
| 177 | Ga0466735_046051 | 3300042624 | Bacteria | 3103 |
| 178 | Ga0466735_087613 | 3300042624 | Bacteria | 2802 |
| 179 | Ga0466709_039419 | 3300042648 | Bacteria | 67557 |
| 180 | 2227515225 | 2225789004 | Bacteria | 684 |
| 181 | JGI24699J35502_10567952 | 3300002509 | Unclassified | 659 |
| 182 | JGI24699J35502_11134140 | 3300002509 | Bacteria | 36834 |
| 183 | Ga0466711_138134 | 3300042615 | Bacteria | 2276 |
| 184 | Ga0466723_125157 | 3300042618 | Unclassified | 14183 |
| 185 | Ga0466726_421376 | 3300042619 | Bacteria | 1745 |
| 186 | Ga0264413_153653 | 3300024493 | Unclassified | 1051 |
| 187 | Ga0466690_111688 | 3300042590 | Bacteria | 4229 |
| 188 | Ga0466692_041750 | 3300042591 | Bacteria | 4583 |
| 189 | Ga0466696_158180 | 3300042596 | Bacteria | 11329 |
| 190 | Ga0466696_424851 | 3300042596 | Unclassified | 1905 |
| 191 | Ga0466701_081334 | 3300042598 | Bacteria | 7784 |
| 192 | Ga0466706_053578 | 3300042599 | Bacteria | 5209 |
| 193 | Ga0466700_276734 | 3300042600 | Bacteria | 4366 |
| 194 | Ga0466713_086089 | 3300042602 | Bacteria | 7859 |
| 195 | Ga0466716_070692 | 3300042605 | Unclassified | 2271 |
| 196 | Ga0466719_111948 | 3300042606 | Bacteria | 2655 |
| 197 | Ga0466698_127176 | 3300042610 | Bacteria | 1584 |
| 198 | Ga0123357_10239086 | 3300009784 | Bacteria | 1971 |
| 199 | Ga0123356_11433055 | 3300010049 | Bacteria | 850 |
| 200 | Ga0123356_11905870 | 3300010049 | Bacteria | 740 |
| 201 | Ga0123356_13972629 | 3300010049 | Bacteria | 510 |
| 202 | Ga0123354_10002936 | 3300010882 | Bacteria | 23138 |
| 203 | Ga0466705_227523 | 3300042612 | Bacteria | 1236 |
| 204 | Ga0466705_363689 | 3300042612 | Bacteria | 10686 |
| 205 | Ga0466733_015696 | 3300042659 | Bacteria | 3397 |
| 206 | Ga0466733_032079 | 3300042659 | Bacteria | 7174 |
| 207 | Ga0466729_279815 | 3300042621 | Bacteria | 3726 |
| 208 | Ga0466731_218717 | 3300042622 | Bacteria | 1139 |
| 209 | Ga0466735_011132 | 3300042624 | Unclassified | 2088 |
| 210 | Ga0466735_022582 | 3300042624 | Bacteria | 1419 |
| 211 | Ga0466735_046064 | 3300042624 | Bacteria | 1774 |
| 212 | Ga0466703_046126 | 3300042636 | Bacteria | 3362 |
| 213 | Ga0466703_163108 | 3300042636 | Bacteria | 4269 |
| 214 | Ga0466704_120588 | 3300042643 | Unclassified | 5042 |
| 215 | Ga0466704_299516 | 3300042643 | Bacteria | 6618 |
| 216 | Ga0068305_10000462 | 3300005083 | Bacteria | 1769 |
| 217 | Ga0123357_10001938 | 3300009784 | Bacteria | 22559 |
| 218 | Ga0466711_031823 | 3300042615 | Bacteria | 5874 |
| 219 | Ga0466711_104265 | 3300042615 | Bacteria | 2055 |
| 220 | Ga0265387_1003446 | 3300024582 | Bacteria | 2180 |
| 221 | Ga0466690_426792 | 3300042590 | Bacteria | 10208 |
| 222 | Ga0466691_195452 | 3300042593 | Bacteria | 11459 |
| 223 | Ga0466696_345739 | 3300042596 | Bacteria | 9366 |
| 224 | Ga0466707_040792 | 3300042601 | Bacteria | 43826 |
| 225 | Ga0466713_068406 | 3300042602 | Bacteria | 13046 |
| 226 | Ga0466713_095735 | 3300042602 | Bacteria | 6510 |
| 227 | Ga0466713_125837 | 3300042602 | Bacteria | 25210 |
| 228 | Ga0466698_296759 | 3300042610 | Bacteria | 1120 |
| 229 | Ga0466697_002140 | 3300042611 | Bacteria | 1239 |
| 230 | Ga0123356_10823358 | 3300010049 | Bacteria | 1099 |
| 231 | Ga0123353_10107178 | 3300010167 | Bacteria | 4502 |
| 232 | Ga0123353_11287536 | 3300010167 | Bacteria | 950 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01649 | Ribosomal_S20p | Ribosomal protein S20 | 2 | 76 | 0.97 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.