Protein Family IF03408
Metagenome
Metatranscriptome
Isolate
134
Members
51
Samples
116
Scaffolds
96.76
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_11846490|Ga0123353_118464902
- Length
- 112 aa
- Sequence
- LSANAIKKEHTKGGKSMNIRPLADRVVIKMLEAEETTKSGIILAGSAKEKPQLAEIVAVGPGGIYDGKDVGKMVVKKGDKVLMSKYAGTEVKVDGIEYTILRQSDILAIVD*
Sample Types
Isolate
13.4%
Metagenome
85.8%
MAG
0.0%
Metatranscriptome
0.8%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
39.2%
Unclassified
23.5%
Kalotermitidae
23.5%
Stratiomyidae
3.9%
Passalidae
3.9%
Termopsidae
3.9%
Hodotermitidae
2.0%
Taxonomy
Archaea
0
Bacteria
122
Eukaryota
0
Viruses
1
Unclassified
11
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820453354 | Unclassified Firmicutes Lab288P3bin172 | Isolate | Unclassified |
| 2 | 2820560510 | Unclassified Firmicutes Emb289P3bin72 | Isolate | Unclassified |
| 3 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 7 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 8 | 2820520043 | Unclassified Firmicutes Lab288P1bin24 | Isolate | Unclassified |
| 9 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 10 | 651324002 | Acetonema longum APO-1, DSM 6540 | Isolate | Kalotermitidae |
| 11 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 12 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 13 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 14 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 15 | 2820294436 | Unclassified Firmicutes Th196P3bin104 | Isolate | Unclassified |
| 16 | 2820451402 | Unclassified Firmicutes Lab288P3bin174 | Isolate | Unclassified |
| 17 | 8030343600 | Proteiniborus sp. MB09-C3 | Isolate | Stratiomyidae |
| 18 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 19 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 20 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 21 | 2820570671 | Unclassified Firmicutes Emb289P3bin19 | Isolate | Unclassified |
| 22 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 23 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 24 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 25 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 26 | 3300022232 | Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA | Metatranscriptome | Termitidae |
| 27 | 2593339124 | Clostridium sp. 4 | Isolate | Termitidae |
| 28 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 29 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 30 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 31 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 32 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 33 | 2590828839 | Clostridium sp. 1 | Isolate | Termitidae |
| 34 | 2820254385 | Unclassified Firmicutes Th196P3bin54 | Isolate | Unclassified |
| 35 | 2820275298 | Unclassified Firmicutes Th196P3bin17 | Isolate | Unclassified |
| 36 | 2828505942 | Spirobacillus cienkowskii binning01 | Isolate | Unclassified |
| 37 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 38 | 8030337018 | Tissierella sp. Yu-01 | Isolate | Stratiomyidae |
| 39 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 40 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 41 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 42 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 43 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 44 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 45 | 2820272499 | Unclassified Firmicutes Th196P3bin18 | Isolate | Unclassified |
| 46 | 2820362221 | Unclassified Firmicutes Nt197P3bin116 | Isolate | Unclassified |
| 47 | 2820373881 | Unclassified Firmicutes Nt197P3bin10 | Isolate | Unclassified |
| 48 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 49 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 50 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 51 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466706_256174 | 3300042599 | Unclassified | 8562 |
| 2 | Ga0466719_382326 | 3300042606 | Bacteria | 5503 |
| 3 | Ga0466721_240883 | 3300042608 | Bacteria | 7632 |
| 4 | Ga0123356_12286271 | 3300010049 | Bacteria | 676 |
| 5 | Ga0123356_12865642 | 3300010049 | Bacteria | 603 |
| 6 | Ga0123356_13343840 | 3300010049 | Bacteria | 557 |
| 7 | Ga0123353_10063776 | 3300010167 | Bacteria | 5910 |
| 8 | Ga0123353_10073738 | 3300010167 | Bacteria | 5486 |
| 9 | Ga0123353_11789017 | 3300010167 | Bacteria | 764 |
| 10 | Ga0123353_11846490 | 3300010167 | Unclassified | 748 |
| 11 | Ga0466735_185760 | 3300042624 | Bacteria | 3914 |
| 12 | Ga0466709_389271 | 3300042648 | Bacteria | 2543 |
| 13 | JGI24702J35022_10109787 | 3300002462 | Bacteria | 1516 |
| 14 | Ga0072940_1127337 | 3300005200 | Bacteria | 3226 |
| 15 | Ga0415639_006490 | 3300038395 | Bacteria | 35011 |
| 16 | Ga0415639_135888 | 3300038395 | Unclassified | 1155 |
| 17 | Ga0466690_032742 | 3300042590 | Unclassified | 2568 |
| 18 | Ga0123355_10013979 | 3300009826 | Bacteria | 12520 |
| 19 | Ga0123355_10247297 | 3300009826 | Bacteria | 2517 |
| 20 | Ga0123353_10339071 | 3300010167 | Bacteria | 2271 |
| 21 | Ga0123353_10567066 | 3300010167 | Bacteria | 1633 |
| 22 | Ga0123353_10635914 | 3300010167 | Bacteria | 1515 |
| 23 | Ga0123353_11177919 | 3300010167 | Bacteria | 1008 |
| 24 | Ga0466702_115756 | 3300042635 | Bacteria | 15679 |
| 25 | IMNBL1DRAFT_c0001553 | 3300000062 | Bacteria | 17103 |
| 26 | JGI24696J40584_12886958 | 3300002834 | Bacteria | 1111 |
| 27 | Ga0466697_281967 | 3300042611 | Bacteria | 1825 |
| 28 | Ga0466705_233983 | 3300042612 | Bacteria | 5840 |
| 29 | Ga0415639_000540 | 3300038395 | Bacteria | 33006 |
| 30 | Ga0415639_002219 | 3300038395 | Bacteria | 72784 |
| 31 | Ga0123355_10448144 | 3300009826 | Bacteria | 1629 |
| 32 | Ga0123355_11437115 | 3300009826 | Bacteria | 678 |
| 33 | Ga0123356_10102846 | 3300010049 | Bacteria | 2743 |
| 34 | Ga0123356_10760568 | 3300010049 | Bacteria | 1139 |
| 35 | Ga0123356_12212509 | 3300010049 | Unclassified | 687 |
| 36 | Ga0123353_10001115 | 3300010167 | Bacteria | 32664 |
| 37 | Ga0123353_10025399 | 3300010167 | Bacteria | 9027 |
| 38 | Ga0123353_10047437 | 3300010167 | Bacteria | 6832 |
| 39 | Ga0466703_396510 | 3300042636 | Bacteria | 240496 |
| 40 | Ga0466728_182156 | 3300042620 | Bacteria | 62762 |
| 41 | IMNBL1DRAFT_c0029850 | 3300000062 | Bacteria | 2010 |
| 42 | AustNasuHG_c1000246 | 3300000089 | Bacteria | 18338 |
| 43 | JGI24705J35276_12205632 | 3300002504 | Unclassified | 1701 |
| 44 | Ga0466705_249330 | 3300042612 | Bacteria | 3643 |
| 45 | Ga0415639_008617 | 3300038395 | Bacteria | 23471 |
| 46 | Ga0415639_073198 | 3300038395 | Bacteria | 6510 |
| 47 | Ga0466706_175552 | 3300042599 | Bacteria | 4885 |
| 48 | Ga0466714_001240 | 3300042603 | Bacteria | 1143 |
| 49 | Ga0466716_183734 | 3300042605 | Bacteria | 316127 |
| 50 | Ga0123356_10068531 | 3300010049 | Bacteria | 3324 |
| 51 | Ga0123356_10385951 | 3300010049 | Bacteria | 1534 |
| 52 | Ga0123356_10879317 | 3300010049 | Bacteria | 1067 |
| 53 | Ga0123356_12209522 | 3300010049 | Bacteria | 688 |
| 54 | Ga0123353_10014843 | 3300010167 | Bacteria | 11265 |
| 55 | Ga0123353_10027537 | 3300010167 | Bacteria | 8712 |
| 56 | Ga0123353_10720036 | 3300010167 | Bacteria | 1396 |
| 57 | Ga0123353_10991345 | 3300010167 | Bacteria | 1130 |
| 58 | Ga0123353_13406444 | 3300010167 | Unclassified | 504 |
| 59 | Ga0123354_10714435 | 3300010882 | Bacteria | 696 |
| 60 | Ga0466703_257873 | 3300042636 | Bacteria | 13293 |
| 61 | Ga0466708_015351 | 3300042652 | Bacteria | 125434 |
| 62 | Ga0466728_339336 | 3300042620 | Bacteria | 1957 |
| 63 | Ga0233288_1036002 | 3300022232 | Unclassified | 537 |
| 64 | Ga0415639_006492 | 3300038395 | Bacteria | 23076 |
| 65 | Ga0466691_073968 | 3300042593 | Bacteria | 10251 |
| 66 | Ga0466706_169135 | 3300042599 | Bacteria | 5748 |
| 67 | Ga0123356_10063704 | 3300010049 | Bacteria | 3445 |
| 68 | Ga0123356_10112292 | 3300010049 | Bacteria | 2634 |
| 69 | Ga0123356_13425238 | 3300010049 | Bacteria | 550 |
| 70 | Ga0123353_10161888 | 3300010167 | Bacteria | 3562 |
| 71 | Ga0123353_10338717 | 3300010167 | Bacteria | 2273 |
| 72 | IMNBL1DRAFT_c0006255 | 3300000062 | Bacteria | 6540 |
| 73 | IMNBL1DRAFT_c0119438 | 3300000062 | Bacteria | 693 |
| 74 | Ga0466706_272568 | 3300042599 | Bacteria | 1571 |
| 75 | Ga0466700_472096 | 3300042600 | Bacteria | 1532 |
| 76 | Ga0123355_10844467 | 3300009826 | Bacteria | 1009 |
| 77 | Ga0123356_10061329 | 3300010049 | Unclassified | 3512 |
| 78 | Ga0123356_10095511 | 3300010049 | Bacteria | 2841 |
| 79 | Ga0123356_10492270 | 3300010049 | Bacteria | 1381 |
| 80 | Ga0123356_11091812 | 3300010049 | Bacteria | 966 |
| 81 | Ga0123356_11861795 | 3300010049 | Bacteria | 749 |
| 82 | Ga0123353_10014131 | 3300010167 | Bacteria | 11489 |
| 83 | Ga0123354_10392863 | 3300010882 | Bacteria | 1183 |
| 84 | Ga0466727_307129 | 3300042655 | Bacteria | 3399 |
| 85 | Ga0466715_222946 | 3300042616 | Bacteria | 16465 |
| 86 | 2227474630 | 2225789004 | Bacteria | 22807 |
| 87 | 2227478271 | 2225789004 | Bacteria | 868 |
| 88 | Ga0466717_148522 | 3300042604 | Bacteria | 1199 |
| 89 | Ga0123357_10918580 | 3300009784 | Bacteria | 561 |
| 90 | Ga0123355_10211456 | 3300009826 | Bacteria | 2810 |
| 91 | Ga0123356_10026716 | 3300010049 | Bacteria | 5416 |
| 92 | Ga0123353_10058356 | 3300010167 | Bacteria | 6184 |
| 93 | Ga0123353_10529152 | 3300010167 | Bacteria | 1707 |
| 94 | Ga0123353_12665537 | 3300010167 | Bacteria | 590 |
| 95 | Ga0466704_253714 | 3300042643 | Bacteria | 53987 |
| 96 | JGI24702J35022_10106321 | 3300002462 | Bacteria | 1540 |
| 97 | Ga0072940_1064494 | 3300005200 | Bacteria | 2316 |
| 98 | Ga0466706_119130 | 3300042599 | Viruses | 1120 |
| 99 | Ga0123355_10054398 | 3300009826 | Bacteria | 6485 |
| 100 | Ga0123355_10063204 | 3300009826 | Bacteria | 5971 |
| 101 | Ga0123355_10081167 | 3300009826 | Bacteria | 5175 |
| 102 | Ga0123355_10359718 | 3300009826 | Bacteria | 1918 |
| 103 | Ga0123355_11035580 | 3300009826 | Bacteria | 865 |
| 104 | Ga0123356_10000473 | 3300010049 | Bacteria | 45077 |
| 105 | Ga0123356_10693581 | 3300010049 | Bacteria | 1187 |
| 106 | Ga0123356_12123257 | 3300010049 | Unclassified | 701 |
| 107 | Ga0123353_10039545 | 3300010167 | Bacteria | 7427 |
| 108 | Ga0123353_10129141 | 3300010167 | Bacteria | 4058 |
| 109 | Ga0123353_10278003 | 3300010167 | Unclassified | 2574 |
| 110 | Ga0123353_10611271 | 3300010167 | Bacteria | 1555 |
| 111 | Ga0123353_12514620 | 3300010167 | Bacteria | 612 |
| 112 | Ga0123353_12590976 | 3300010167 | Bacteria | 600 |
| 113 | Ga0123353_12765346 | 3300010167 | Bacteria | 576 |
| 114 | Ga0466727_242980 | 3300042655 | Bacteria | 1236 |
| 115 | IMNBL1DRAFT_c0000003 | 3300000062 | Bacteria | 275310 |
| 116 | JGI24696J40584_12942914 | 3300002834 | Bacteria | 1756 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00166 | Cpn10 | Chaperonin 10 Kd subunit | 18 | 110 | 0.97 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.