Protein Family IF03382
Metagenome
Metatranscriptome
Isolate
220
Members
87
Samples
176
Scaffolds
132.73
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_11169163|Ga0123353_111691632
- Length
- 146 aa
- Sequence
- LIYKRIGKIGEGRNLMAKVLYYGTGRRKKSVARVNLIPGGGAVKINDRDIDDYFGLETLKVIVKQPLTLTNTLSSFDVVCTVKGGGFTGQAGAIRHGIARALLKADEELRPELKRAGYLTRDPRMKERKKYGLKKARRAPQFSKR*
Sample Types
Isolate
20.0%
Metagenome
79.5%
MAG
0.0%
Metatranscriptome
0.5%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
33.3%
Termitidae
27.6%
Blattidae
16.1%
Kalotermitidae
11.5%
Rhinotermitidae
3.4%
Passalidae
2.3%
Termopsidae
2.3%
Hodotermitidae
1.1%
Tenebrionidae
1.1%
Stratiomyidae
1.1%
Taxonomy
Archaea
0
Bacteria
180
Eukaryota
0
Viruses
0
Unclassified
40
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940264388 | Lachnospiraceae bacterium PFB1-17 | Isolate | Blattidae |
| 2 | 2940267548 | Lachnospiraceae bacterium PFB1-22 | Isolate | Blattidae |
| 3 | 2940280053 | Lachnospiraceae bacterium PF1-22 | Isolate | Blattidae |
| 4 | 2944625312 | Dysgonomonas sp. PF1-3 | Isolate | Blattidae |
| 5 | 2820285501 | Unclassified Firmicutes Th196P3bin142 | Isolate | Unclassified |
| 6 | 2820447167 | Unclassified Firmicutes Lab288P3bin192 | Isolate | Unclassified |
| 7 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 8 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 9 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 10 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 11 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 12 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 13 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 14 | 2940277027 | Lachnospiraceae bacterium PF1-21 | Isolate | Blattidae |
| 15 | 2820267566 | Unclassified Firmicutes Th196P3bin33 | Isolate | Unclassified |
| 16 | 2820336130 | Unclassified Firmicutes Nt197P3bin70 | Isolate | Unclassified |
| 17 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 18 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 19 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 20 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 21 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 22 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 23 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 24 | 2940270707 | Lachnoclostridium sp. PF1-13 | Isolate | Blattidae |
| 25 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 26 | 2820329821 | Unclassified Firmicutes Nt197P3bin77 | Isolate | Unclassified |
| 27 | 2820382897 | Unclassified Firmicutes Nt197P1bin3 | Isolate | Unclassified |
| 28 | 2820576413 | Unclassified Firmicutes Emb289P3bin136 | Isolate | Unclassified |
| 29 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 30 | 2940292506 | Lachnoclostridium sp. PH5-23 | Isolate | Blattidae |
| 31 | 2529293168 | Ruminiclostridium cellobioparum termitidis CT1112 | Isolate | Termitidae |
| 32 | 2590828840 | Clostridium sp. 2 | Isolate | Termitidae |
| 33 | 2820242869 | Unclassified Firmicutes Th196P3bin82 | Isolate | Unclassified |
| 34 | 2820551407 | Unclassified Firmicutes Emb289P4bin38 | Isolate | Unclassified |
| 35 | 2820584674 | Unclassified Firmicutes Emb289P1bin98 | Isolate | Unclassified |
| 36 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 37 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 38 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 39 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 40 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 41 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 42 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 43 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 44 | 2940273867 | Lachnoclostridium sp. PH1-16 | Isolate | Blattidae |
| 45 | 2940289514 | Lachnospiraceae bacterium PM6-15 | Isolate | Blattidae |
| 46 | 2820472365 | Unclassified Firmicutes Lab288P1bin87 | Isolate | Unclassified |
| 47 | 2820474468 | Unclassified Firmicutes Lab288P1bin84 | Isolate | Unclassified |
| 48 | 2820634724 | Unclassified Firmicutes Emb289P1bin116 | Isolate | Unclassified |
| 49 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 50 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 51 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 52 | 2940286528 | Lachnospiraceae bacterium PFB1-21 | Isolate | Blattidae |
| 53 | 2820252425 | Unclassified Firmicutes Th196P3bin6 | Isolate | Unclassified |
| 54 | 2820391468 | Unclassified Firmicutes Nc150P3bin1 | Isolate | Unclassified |
| 55 | 2820429680 | Unclassified Firmicutes Lab288P3bin30 | Isolate | Unclassified |
| 56 | 2820522177 | Unclassified Firmicutes Lab288P1bin22 | Isolate | Unclassified |
| 57 | 2820541116 | Unclassified Firmicutes Lab288P1bin109 | Isolate | Unclassified |
| 58 | 2820654856 | Unclassified Firmicutes Cu122P1bin2 | Isolate | Unclassified |
| 59 | 8030343600 | Proteiniborus sp. MB09-C3 | Isolate | Stratiomyidae |
| 60 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 61 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 62 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 63 | 3300022820 | Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA | Metatranscriptome | Termitidae |
| 64 | 2940233634 | Lachnoclostridium sp. PF5-10 | Isolate | Blattidae |
| 65 | 2820223845 | Unclassified Firmicutes Th196P4bin57 | Isolate | Unclassified |
| 66 | 2820414148 | Unclassified Firmicutes Lab288P3bin93 | Isolate | Unclassified |
| 67 | 2820657860 | Unclassified Firmicutes Co191P4bin15 | Isolate | Unclassified |
| 68 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 69 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 70 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 71 | 2940230426 | Lachnospiraceae bacterium PH5-48 | Isolate | Blattidae |
| 72 | 2940283334 | Lachnospiraceae bacterium PF1-4 | Isolate | Blattidae |
| 73 | 2940295490 | Lachnospiraceae bacterium PH1-22 | Isolate | Blattidae |
| 74 | 2820420508 | Unclassified Firmicutes Lab288P3bin68 | Isolate | Unclassified |
| 75 | 2820462123 | Unclassified Firmicutes Lab288P3bin129 | Isolate | Unclassified |
| 76 | 2820492969 | Unclassified Firmicutes Lab288P1bin6 | Isolate | Unclassified |
| 77 | 2820613375 | Unclassified Firmicutes Emb289P1bin134 | Isolate | Unclassified |
| 78 | 2820705605 | Unclassified Firmicutes Co191P1bin34 | Isolate | Unclassified |
| 79 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 80 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 81 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 82 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 83 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 84 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 85 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 86 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 87 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_266655 | 3300042611 | Bacteria | 2900 |
| 2 | Ga0415639_104324 | 3300038395 | Unclassified | 4130 |
| 3 | Ga0123355_10804007 | 3300009826 | Bacteria | 1048 |
| 4 | Ga0123356_10931451 | 3300010049 | Bacteria | 1040 |
| 5 | Ga0123356_10987924 | 3300010049 | Unclassified | 1012 |
| 6 | Ga0123356_11508464 | 3300010049 | Bacteria | 830 |
| 7 | Ga0123356_12095898 | 3300010049 | Bacteria | 706 |
| 8 | Ga0123353_10002848 | 3300010167 | Bacteria | 21620 |
| 9 | Ga0123353_10013554 | 3300010167 | Bacteria | 11684 |
| 10 | Ga0123353_10113265 | 3300010167 | Unclassified | 4366 |
| 11 | Ga0123354_10098016 | 3300010882 | Bacteria | 3990 |
| 12 | Ga0123354_10753148 | 3300010882 | Bacteria | 667 |
| 13 | Ga0466735_140576 | 3300042624 | Bacteria | 1915 |
| 14 | Ga0466702_186124 | 3300042635 | Bacteria | 1009 |
| 15 | Ga0466704_578958 | 3300042643 | Unclassified | 2539 |
| 16 | Ga0466706_145795 | 3300042599 | Bacteria | 7456 |
| 17 | Ga0466706_229575 | 3300042599 | Bacteria | 2094 |
| 18 | Ga0466707_264425 | 3300042601 | Bacteria | 1038 |
| 19 | Ga0466707_358649 | 3300042601 | Bacteria | 3678 |
| 20 | Ga0466713_154533 | 3300042602 | Bacteria | 1102 |
| 21 | Ga0466717_034670 | 3300042604 | Bacteria | 1315 |
| 22 | Ga0466718_026329 | 3300042617 | Bacteria | 1417 |
| 23 | JGI24703J35330_11136092 | 3300002501 | Bacteria | 715 |
| 24 | JGI24696J40584_12953147 | 3300002834 | Unclassified | 2439 |
| 25 | Ga0255809_1100302 | 3300022820 | Bacteria | 1070 |
| 26 | Ga0466693_344992 | 3300042592 | Bacteria | 1910 |
| 27 | Ga0123357_10005370 | 3300009784 | Bacteria | 15323 |
| 28 | Ga0123355_10002723 | 3300009826 | Bacteria | 25034 |
| 29 | Ga0123355_10028703 | 3300009826 | Unclassified | 8998 |
| 30 | Ga0123355_10092698 | 3300009826 | Bacteria | 4783 |
| 31 | Ga0123355_10155387 | 3300009826 | Unclassified | 3463 |
| 32 | Ga0123355_10205168 | 3300009826 | Unclassified | 2869 |
| 33 | Ga0123356_10608668 | 3300010049 | Unclassified | 1258 |
| 34 | Ga0123356_10677916 | 3300010049 | Unclassified | 1199 |
| 35 | Ga0123356_10733557 | 3300010049 | Unclassified | 1158 |
| 36 | Ga0123356_11049352 | 3300010049 | Unclassified | 984 |
| 37 | Ga0123353_10001262 | 3300010167 | Bacteria | 31018 |
| 38 | Ga0123353_10248603 | 3300010167 | Bacteria | 2756 |
| 39 | Ga0123353_11446395 | 3300010167 | Bacteria | 880 |
| 40 | Ga0466703_129300 | 3300042636 | Bacteria | 1457 |
| 41 | Ga0466703_326192 | 3300042636 | Bacteria | 5797 |
| 42 | Ga0466717_188902 | 3300042604 | Bacteria | 1738 |
| 43 | Ga0466718_114061 | 3300042617 | Unclassified | 14214 |
| 44 | Ga0466726_128868 | 3300042619 | Unclassified | 1030 |
| 45 | Ga0466728_229445 | 3300042620 | Bacteria | 1673 |
| 46 | 2227619075 | 2225789004 | Unclassified | 11842 |
| 47 | JGI24695J34938_10043440 | 3300002450 | Bacteria | 2005 |
| 48 | JGI24695J34938_10149545 | 3300002450 | Unclassified | 957 |
| 49 | Ga0466697_220607 | 3300042611 | Bacteria | 1196 |
| 50 | Ga0466733_069873 | 3300042659 | Bacteria | 1638 |
| 51 | Ga0466693_295887 | 3300042592 | Unclassified | 1184 |
| 52 | Ga0123357_10566358 | 3300009784 | Bacteria | 895 |
| 53 | Ga0123355_10000703 | 3300009826 | Bacteria | 45383 |
| 54 | Ga0123355_10259367 | 3300009826 | Bacteria | 2433 |
| 55 | Ga0123356_10005048 | 3300010049 | Unclassified | 13527 |
| 56 | Ga0123356_11673763 | 3300010049 | Bacteria | 789 |
| 57 | Ga0123353_10025700 | 3300010167 | Bacteria | 8978 |
| 58 | Ga0123353_10039699 | 3300010167 | Bacteria | 7415 |
| 59 | Ga0123353_10754744 | 3300010167 | Bacteria | 1353 |
| 60 | Ga0466722_184954 | 3300042609 | Bacteria | 79638 |
| 61 | Ga0466715_485227 | 3300042616 | Bacteria | 29325 |
| 62 | Ga0466726_097967 | 3300042619 | Bacteria | 17408 |
| 63 | Ga0466726_194734 | 3300042619 | Bacteria | 37464 |
| 64 | IMNBL1DRAFT_c0076860 | 3300000062 | Bacteria | 946 |
| 65 | JGI24702J35022_10035926 | 3300002462 | Unclassified | 2649 |
| 66 | Ga0466697_108488 | 3300042611 | Bacteria | 1183 |
| 67 | Ga0466694_264558 | 3300042594 | Bacteria | 1394 |
| 68 | Ga0123355_10534351 | 3300009826 | Unclassified | 1427 |
| 69 | Ga0123355_10564714 | 3300009826 | Bacteria | 1369 |
| 70 | Ga0123355_10582007 | 3300009826 | Bacteria | 1337 |
| 71 | Ga0123355_11830767 | 3300009826 | Unclassified | 571 |
| 72 | Ga0123356_10804629 | 3300010049 | Bacteria | 1111 |
| 73 | Ga0123356_11323444 | 3300010049 | Bacteria | 883 |
| 74 | Ga0123353_10000396 | 3300010167 | Bacteria | 53672 |
| 75 | Ga0123353_10004072 | 3300010167 | Bacteria | 18733 |
| 76 | Ga0123353_11169163 | 3300010167 | Bacteria | 1013 |
| 77 | Ga0123354_10102072 | 3300010882 | Bacteria | 3869 |
| 78 | Ga0123354_10402543 | 3300010882 | Bacteria | 1157 |
| 79 | Ga0466703_114123 | 3300042636 | Bacteria | 1737 |
| 80 | Ga0466703_334607 | 3300042636 | Bacteria | 27709 |
| 81 | Ga0466704_064085 | 3300042643 | Bacteria | 388657 |
| 82 | Ga0466704_497959 | 3300042643 | Unclassified | 16938 |
| 83 | Ga0466706_152943 | 3300042599 | Bacteria | 48130 |
| 84 | Ga0466700_129096 | 3300042600 | Bacteria | 1226 |
| 85 | IMNBL1DRAFT_c0021783 | 3300000062 | Bacteria | 2554 |
| 86 | Ga0466705_096912 | 3300042612 | Bacteria | 15671 |
| 87 | Ga0466705_296192 | 3300042612 | Unclassified | 1307 |
| 88 | Ga0466692_127384 | 3300042591 | Bacteria | 123881 |
| 89 | Ga0123355_10000245 | 3300009826 | Bacteria | 69826 |
| 90 | Ga0123355_10000396 | 3300009826 | Bacteria | 56655 |
| 91 | Ga0123355_10001623 | 3300009826 | Unclassified | 31403 |
| 92 | Ga0123355_10002712 | 3300009826 | Bacteria | 25096 |
| 93 | Ga0123355_10041929 | 3300009826 | Bacteria | 7451 |
| 94 | Ga0123355_10576882 | 3300009826 | Bacteria | 1347 |
| 95 | Ga0123356_10409425 | 3300010049 | Unclassified | 1495 |
| 96 | Ga0123356_11245200 | 3300010049 | Bacteria | 909 |
| 97 | Ga0123356_12196472 | 3300010049 | Bacteria | 690 |
| 98 | Ga0123353_10005937 | 3300010167 | Bacteria | 16155 |
| 99 | Ga0123353_10058073 | 3300010167 | Unclassified | 6199 |
| 100 | Ga0123353_11083507 | 3300010167 | Bacteria | 1066 |
| 101 | Ga0123354_10423069 | 3300010882 | Bacteria | 1105 |
| 102 | Ga0466729_305099 | 3300042621 | Bacteria | 3302 |
| 103 | Ga0466709_325027 | 3300042648 | Bacteria | 23259 |
| 104 | Ga0466700_364712 | 3300042600 | Bacteria | 1811 |
| 105 | Ga0466713_012840 | 3300042602 | Bacteria | 82346 |
| 106 | Ga0466722_136347 | 3300042609 | Bacteria | 1449 |
| 107 | Ga0466722_208763 | 3300042609 | Bacteria | 8636 |
| 108 | Ga0466711_516971 | 3300042615 | Bacteria | 5043 |
| 109 | Ga0466726_100199 | 3300042619 | Bacteria | 28393 |
| 110 | Ga0466726_211843 | 3300042619 | Unclassified | 2627 |
| 111 | Ga0466705_117688 | 3300042612 | Bacteria | 16740 |
| 112 | Ga0466733_015930 | 3300042659 | Bacteria | 1194 |
| 113 | Ga0466694_206885 | 3300042594 | Bacteria | 1463 |
| 114 | Ga0123355_10009474 | 3300009826 | Unclassified | 14816 |
| 115 | Ga0123355_10588077 | 3300009826 | Bacteria | 1327 |
| 116 | Ga0123356_11997185 | 3300010049 | Bacteria | 723 |
| 117 | Ga0123353_10022046 | 3300010167 | Bacteria | 9583 |
| 118 | Ga0123353_10293298 | 3300010167 | Unclassified | 2488 |
| 119 | Ga0123353_10872936 | 3300010167 | Bacteria | 1229 |
| 120 | Ga0123353_11161475 | 3300010167 | Unclassified | 1018 |
| 121 | Ga0123353_11624852 | 3300010167 | Bacteria | 814 |
| 122 | Ga0123353_12907119 | 3300010167 | Bacteria | 558 |
| 123 | Ga0466708_287332 | 3300042652 | Bacteria | 17770 |
| 124 | Ga0466706_189859 | 3300042599 | Unclassified | 5106 |
| 125 | Ga0466713_005920 | 3300042602 | Bacteria | 33790 |
| 126 | Ga0466716_443479 | 3300042605 | Bacteria | 3023 |
| 127 | Ga0466705_519349 | 3300042612 | Bacteria | 2844 |
| 128 | Ga0466711_340348 | 3300042615 | Bacteria | 1984 |
| 129 | Ga0466729_043603 | 3300042621 | Bacteria | 7258 |
| 130 | 2227531302 | 2225789004 | Bacteria | 3148 |
| 131 | JGI24702J35022_10321901 | 3300002462 | Bacteria | 917 |
| 132 | JGI24703J35330_11748409 | 3300002501 | Bacteria | 15643 |
| 133 | Ga0562375_0042 | 3300056856 | Bacteria | 527811 |
| 134 | Ga0123355_10005720 | 3300009826 | Bacteria | 18266 |
| 135 | Ga0123355_10031403 | 3300009826 | Bacteria | 8618 |
| 136 | Ga0123355_10058202 | 3300009826 | Bacteria | 6253 |
| 137 | Ga0123355_10259299 | 3300009826 | Bacteria | 2433 |
| 138 | Ga0123355_10453740 | 3300009826 | Bacteria | 1614 |
| 139 | Ga0123355_11217026 | 3300009826 | Bacteria | 767 |
| 140 | Ga0123355_11379983 | 3300009826 | Bacteria | 699 |
| 141 | Ga0123356_10079039 | 3300010049 | Bacteria | 3106 |
| 142 | Ga0123356_10400808 | 3300010049 | Bacteria | 1509 |
| 143 | Ga0123356_13139648 | 3300010049 | Bacteria | 576 |
| 144 | Ga0123353_10162467 | 3300010167 | Unclassified | 3554 |
| 145 | Ga0123353_10439563 | 3300010167 | Unclassified | 1925 |
| 146 | Ga0466704_411261 | 3300042643 | Bacteria | 5218 |
| 147 | Ga0466706_165247 | 3300042599 | Bacteria | 1211 |
| 148 | Ga0466700_124038 | 3300042600 | Bacteria | 1387 |
| 149 | Ga0466707_306383 | 3300042601 | Bacteria | 2217 |
| 150 | Ga0466713_057398 | 3300042602 | Bacteria | 69724 |
| 151 | Ga0466719_477917 | 3300042606 | Bacteria | 48959 |
| 152 | Ga0466710_129913 | 3300042613 | Unclassified | 1157 |
| 153 | 2227527982 | 2225789004 | Unclassified | 3206 |
| 154 | JGI24702J35022_10000445 | 3300002462 | Bacteria | 24915 |
| 155 | JGI24702J35022_10160046 | 3300002462 | Bacteria | 1268 |
| 156 | JGI24696J40584_12958796 | 3300002834 | Unclassified | 4412 |
| 157 | Ga0415639_031258 | 3300038395 | Bacteria | 6639 |
| 158 | Ga0415639_058403 | 3300038395 | Bacteria | 3184 |
| 159 | Ga0466695_076042 | 3300042595 | Unclassified | 1303 |
| 160 | Ga0123355_10000060 | 3300009826 | Bacteria | 115952 |
| 161 | Ga0123355_10926797 | 3300009826 | Unclassified | 940 |
| 162 | Ga0123355_11124706 | 3300009826 | Bacteria | 813 |
| 163 | Ga0123356_10464577 | 3300010049 | Bacteria | 1416 |
| 164 | Ga0123353_10013129 | 3300010167 | Unclassified | 11843 |
| 165 | Ga0123353_11169459 | 3300010167 | Bacteria | 1013 |
| 166 | Ga0466729_302719 | 3300042621 | Bacteria | 5328 |
| 167 | Ga0466731_211049 | 3300042622 | Bacteria | 2863 |
| 168 | Ga0466703_381067 | 3300042636 | Bacteria | 8392 |
| 169 | Ga0466704_027327 | 3300042643 | Unclassified | 6247 |
| 170 | Ga0466704_556176 | 3300042643 | Bacteria | 31395 |
| 171 | Ga0466700_002473 | 3300042600 | Bacteria | 1144 |
| 172 | Ga0466717_098245 | 3300042604 | Bacteria | 1081 |
| 173 | Ga0466719_201247 | 3300042606 | Bacteria | 254275 |
| 174 | Ga0466722_022549 | 3300042609 | Bacteria | 126509 |
| 175 | Ga0466711_117114 | 3300042615 | Bacteria | 26406 |
| 176 | IMNBL1DRAFT_c0000083 | 3300000062 | Bacteria | 85596 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00380 | Ribosomal_S9 | Ribosomal protein S9/S16 | 25 | 145 | 0.99 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.