Protein Family IF03375
Metagenome
Isolate
276
Members
119
Samples
216
Scaffolds
253.08
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_11073692|Ga0123353_110736921
- Length
- 290 aa
- Sequence
- MRKKLIAGNWKMNKTAAQASVLAQEIKRLVGGPPCEVVLCVPFTALHAVKDVLDGSDIYSNVHSPGIRREQAPALQSSDNNSSLPSDHCPLTTDHSLQLGAQNVAWADNGAFTGEISAEMLKEAGAAYVIVGHSERRALFGETDKTVFLRAKKALDSGLIPIVCIGETLEQRQKGETDSVNEKQLREGLKGLTAADLDNVVIAYEPVWAIGTGMTATKEDADAAIAYIRGVAAKMFDKVTADKLRIQYGGSMNAQNCAELMSMPNIDGGLIGGASLKADDFAVIVKSAG*
Sample Types
Isolate
21.7%
Metagenome
78.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
29.8%
Termitidae
18.4%
Blattidae
15.8%
Kalotermitidae
10.5%
Formicidae
6.1%
Rhinotermitidae
2.6%
Passalidae
2.6%
Curculionidae
2.6%
Termopsidae
1.8%
Thomisidae
0.9%
Hodotermitidae
0.9%
Armadillidiidae
0.9%
Cerambycidae
0.9%
Hydrophilidae
0.9%
Nephropidae
0.9%
Elmidae
0.9%
Dytiscidae
0.9%
Noctuidae
0.9%
Largidae
0.9%
Apidae
0.9%
Taxonomy
Archaea
0
Bacteria
270
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940236825 | Breznakia sp. PM6-1 | Isolate | Blattidae |
| 2 | 2940264388 | Lachnospiraceae bacterium PFB1-17 | Isolate | Blattidae |
| 3 | 2940267548 | Lachnospiraceae bacterium PFB1-22 | Isolate | Blattidae |
| 4 | 2940341480 | Breznakia sp. PFB2-8 | Isolate | Blattidae |
| 5 | 2940356891 | Breznakia sp. PFB1-11 | Isolate | Blattidae |
| 6 | 2940364193 | Breznakia sp. PFB1-19 | Isolate | Blattidae |
| 7 | 2630969010 | Friedmanniella luteola DSM 21741 | Isolate | Thomisidae |
| 8 | 2820546020 | Unclassified Firmicutes Lab288P1bin102 | Isolate | Unclassified |
| 9 | 2820620956 | Unclassified Firmicutes Emb289P1bin128 | Isolate | Unclassified |
| 10 | 2820626145 | Unclassified Firmicutes Emb289P1bin123 | Isolate | Unclassified |
| 11 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 12 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 13 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 14 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 15 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 16 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 17 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 18 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 19 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 20 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 21 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 22 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 23 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 24 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 25 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 26 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 27 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 28 | 2931430189 | Tessaracoccus palaemonis J1M15 | Isolate | |
| 29 | 2084038013 | Anoplophora glabripennis gut microbial communities from Worchester, Massachusetts, USA - Larvae | Metagenome | Cerambycidae |
| 30 | 2820259584 | Unclassified Firmicutes Th196P3bin43 | Isolate | Unclassified |
| 31 | 2820265624 | Unclassified Firmicutes Th196P3bin36 | Isolate | Unclassified |
| 32 | 2820679524 | Unclassified Firmicutes Co191P1bin94 | Isolate | Unclassified |
| 33 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 34 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 35 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 36 | 2940270707 | Lachnoclostridium sp. PF1-13 | Isolate | Blattidae |
| 37 | 2940339133 | Breznakia sp. PF5-3 | Isolate | Blattidae |
| 38 | 2940361758 | Breznakia sp. PFB1-14 | Isolate | Blattidae |
| 39 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 40 | 2820272499 | Unclassified Firmicutes Th196P3bin18 | Isolate | Unclassified |
| 41 | 2820513949 | Unclassified Firmicutes Lab288P1bin39 | Isolate | Unclassified |
| 42 | 2820535361 | Unclassified Firmicutes Lab288P1bin14 | Isolate | Unclassified |
| 43 | 8100461708 | Delftia sp. S65 | Isolate | Curculionidae |
| 44 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 45 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 46 | 2873595552 | Erysipelothrix sp. HDW6C | Isolate | Hydrophilidae |
| 47 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 48 | 2820246658 | Unclassified Firmicutes Th196P3bin70 | Isolate | Unclassified |
| 49 | 2820460928 | Unclassified Firmicutes Lab288P3bin140 | Isolate | Unclassified |
| 50 | 2820637417 | Unclassified Firmicutes Emb289P1bin108 | Isolate | Unclassified |
| 51 | 643348524 | Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 | Isolate | Unclassified |
| 52 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 53 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 54 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 55 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 56 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 57 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 58 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 59 | 2838772460 | Aquimarina sp. I32.4 | Isolate | Nephropidae |
| 60 | 2864968865 | Paucibacter oligotrophus S00239 | Isolate | Elmidae |
| 61 | 2873593402 | Erysipelothrix sp. HDW6A | Isolate | Dytiscidae |
| 62 | 2873597894 | Erysipelothrix sp. HDW6B | Isolate | Unclassified |
| 63 | 2940273867 | Lachnoclostridium sp. PH1-16 | Isolate | Blattidae |
| 64 | 2940359323 | Breznakia sp. PFB1-12 | Isolate | Blattidae |
| 65 | 2940366561 | Breznakia sp. PFB1-4 | Isolate | Blattidae |
| 66 | 2518285616 | Brachymonas chironomi DSM 19884 | Isolate | Unclassified |
| 67 | 2820497731 | Unclassified Firmicutes Lab288P1bin55 | Isolate | Unclassified |
| 68 | 2820504582 | Unclassified Firmicutes Lab288P1bin5 | Isolate | Unclassified |
| 69 | 2820587002 | Unclassified Firmicutes Emb289P1bin94 | Isolate | Unclassified |
| 70 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 71 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 72 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 73 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 74 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 75 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 76 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 77 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 78 | 3300003097 | Cutworm gut microbial communities from Hangzhou, China | Metagenome | Noctuidae |
| 79 | 2894649344 | Allomuricauda alvinocaridis SCR12 | Isolate | Unclassified |
| 80 | 2940343849 | Breznakia sp. PH5-24 | Isolate | Blattidae |
| 81 | 2940352027 | Breznakia sp. PH1-1 | Isolate | Blattidae |
| 82 | 2820242869 | Unclassified Firmicutes Th196P3bin82 | Isolate | Unclassified |
| 83 | 2820348946 | Unclassified Firmicutes Nt197P3bin47 | Isolate | Unclassified |
| 84 | 2820453354 | Unclassified Firmicutes Lab288P3bin172 | Isolate | Unclassified |
| 85 | 2820488713 | Unclassified Firmicutes Lab288P1bin69 | Isolate | Unclassified |
| 86 | 2820512088 | Unclassified Firmicutes Lab288P1bin4 | Isolate | Unclassified |
| 87 | 2820533259 | Unclassified Firmicutes Lab288P1bin140 | Isolate | Unclassified |
| 88 | 2820623020 | Unclassified Firmicutes Emb289P1bin126 | Isolate | Unclassified |
| 89 | 2820669764 | Unclassified Firmicutes Co191P3bin30 | Isolate | Unclassified |
| 90 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 91 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 92 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 93 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 94 | 8100455565 | Delftia sp. S67 | Isolate | Curculionidae |
| 95 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 96 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 97 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 98 | 2940354458 | Breznakia sp. PF1-11 | Isolate | Blattidae |
| 99 | 2788499854 | Breznakia blatticola DSM 28867 | Isolate | Unclassified |
| 100 | 2820501819 | Unclassified Firmicutes Lab288P1bin51 | Isolate | Unclassified |
| 101 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 102 | 8100449422 | Delftia sp. S66 | Isolate | Curculionidae |
| 103 | 3003878002 | Paraburkholderia sp. PGU19 | Isolate | Largidae |
| 104 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 105 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 106 | 3300007733 | Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean | Metagenome | |
| 107 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 108 | 2940368928 | Breznakia sp. PFB2-30 | Isolate | Blattidae |
| 109 | 2820539610 | Unclassified Firmicutes Lab288P1bin136 | Isolate | Unclassified |
| 110 | 2820707375 | Unclassified Firmicutes Co191P1bin31 | Isolate | Unclassified |
| 111 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 112 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 113 | 8065497608 | Tellurirhabdus bombi IE-0392 | Isolate | Apidae |
| 114 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 115 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 116 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 117 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 118 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 119 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_107495 | 3300042659 | Bacteria | 26466 |
| 2 | Ga0466733_125477 | 3300042659 | Bacteria | 1522 |
| 3 | 2227416930 | 2225789004 | Bacteria | 5657 |
| 4 | 2227636576 | 2225789004 | Bacteria | 2086 |
| 5 | IMNBL1DRAFT_c0000700 | 3300000062 | Bacteria | 26812 |
| 6 | Ga0105524_109674 | 3300007733 | Bacteria | 1213 |
| 7 | Ga0466711_080439 | 3300042615 | Bacteria | 3519 |
| 8 | Ga0466715_136727 | 3300042616 | Bacteria | 19915 |
| 9 | Ga0123355_10069242 | 3300009826 | Bacteria | 5673 |
| 10 | Ga0123355_10328317 | 3300009826 | Bacteria | 2053 |
| 11 | Ga0123353_10952987 | 3300010167 | Bacteria | 1160 |
| 12 | Ga0123354_10552696 | 3300010882 | Bacteria | 867 |
| 13 | Ga0466706_103867 | 3300042599 | Bacteria | 23671 |
| 14 | Ga0466714_018415 | 3300042603 | Bacteria | 1068 |
| 15 | Ga0466714_059719 | 3300042603 | Bacteria | 2563 |
| 16 | Ga0466719_204640 | 3300042606 | Bacteria | 4290 |
| 17 | Ga0466733_168047 | 3300042659 | Bacteria | 2024 |
| 18 | AglaG_contig22808 | 2084038013 | Bacteria | 1678 |
| 19 | 2227018998 | 2225789003 | Unclassified | 1039 |
| 20 | 2227049816 | 2225789003 | Bacteria | 3941 |
| 21 | Ga0103268_1000144 | 3300007192 | Bacteria | 23464 |
| 22 | Ga0466705_400322 | 3300042612 | Bacteria | 10790 |
| 23 | Ga0466705_508929 | 3300042612 | Bacteria | 8742 |
| 24 | Ga0466704_542960 | 3300042643 | Bacteria | 13055 |
| 25 | Ga0466724_30683 | 3300042649 | Bacteria | 28177 |
| 26 | Ga0466708_041300 | 3300042652 | Bacteria | 34448 |
| 27 | Ga0264413_139706 | 3300024493 | Bacteria | 8325 |
| 28 | Ga0466690_094693 | 3300042590 | Bacteria | 13567 |
| 29 | Ga0123355_10004048 | 3300009826 | Bacteria | 21250 |
| 30 | Ga0123355_10062965 | 3300009826 | Bacteria | 5985 |
| 31 | Ga0123355_10182160 | 3300009826 | Bacteria | 3115 |
| 32 | Ga0123355_10223119 | 3300009826 | Bacteria | 2706 |
| 33 | Ga0123355_10239097 | 3300009826 | Bacteria | 2577 |
| 34 | Ga0123353_10184434 | 3300010167 | Bacteria | 3301 |
| 35 | Ga0123353_10198518 | 3300010167 | Bacteria | 3159 |
| 36 | Ga0123353_10277757 | 3300010167 | Bacteria | 2575 |
| 37 | Ga0123353_10306744 | 3300010167 | Bacteria | 2419 |
| 38 | Ga0123353_10623979 | 3300010167 | Unclassified | 1534 |
| 39 | Ga0123353_11515923 | 3300010167 | Bacteria | 853 |
| 40 | Ga0123354_10423085 | 3300010882 | Bacteria | 1105 |
| 41 | Ga0466701_022960 | 3300042598 | Bacteria | 58464 |
| 42 | Ga0466706_048403 | 3300042599 | Bacteria | 47707 |
| 43 | Ga0466706_094065 | 3300042599 | Bacteria | 24039 |
| 44 | Ga0466706_203720 | 3300042599 | Bacteria | 2407 |
| 45 | Ga0466706_261989 | 3300042599 | Bacteria | 6823 |
| 46 | Ga0466707_010415 | 3300042601 | Bacteria | 1935 |
| 47 | Ga0466713_157145 | 3300042602 | Bacteria | 71448 |
| 48 | Ga0466714_020081 | 3300042603 | Bacteria | 30959 |
| 49 | Ga0466714_020869 | 3300042603 | Bacteria | 5748 |
| 50 | Ga0466714_103683 | 3300042603 | Bacteria | 4949 |
| 51 | Ga0466714_110595 | 3300042603 | Bacteria | 29714 |
| 52 | Ga0466714_158083 | 3300042603 | Bacteria | 1751 |
| 53 | Ga0466716_413396 | 3300042605 | Bacteria | 18366 |
| 54 | Ga0466722_252821 | 3300042609 | Bacteria | 235840 |
| 55 | Ga0466733_107952 | 3300042659 | Bacteria | 2052 |
| 56 | Ga0466733_156541 | 3300042659 | Bacteria | 2323 |
| 57 | IMNBL1DRAFT_c0000019 | 3300000062 | Bacteria | 170255 |
| 58 | Ga0102739_1000083 | 3300007095 | Bacteria | 26140 |
| 59 | Ga0466711_097238 | 3300042615 | Bacteria | 6306 |
| 60 | Ga0466704_489802 | 3300042643 | Bacteria | 9836 |
| 61 | Ga0466708_019276 | 3300042652 | Bacteria | 21307 |
| 62 | Ga0466708_042015 | 3300042652 | Bacteria | 4174 |
| 63 | Ga0415639_029421 | 3300038395 | Unclassified | 5608 |
| 64 | Ga0466692_003697 | 3300042591 | Bacteria | 64811 |
| 65 | Ga0123355_10163249 | 3300009826 | Bacteria | 3350 |
| 66 | Ga0123355_10210177 | 3300009826 | Bacteria | 2822 |
| 67 | Ga0123355_10285444 | 3300009826 | Bacteria | 2272 |
| 68 | Ga0123355_10342732 | 3300009826 | Bacteria | 1989 |
| 69 | Ga0123356_10135570 | 3300010049 | Bacteria | 2419 |
| 70 | Ga0123353_10209362 | 3300010167 | Bacteria | 3060 |
| 71 | Ga0123353_10751904 | 3300010167 | Bacteria | 1357 |
| 72 | Ga0123353_10949995 | 3300010167 | Unclassified | 1163 |
| 73 | Ga0123353_11170030 | 3300010167 | Bacteria | 1013 |
| 74 | Ga0160465_101031 | 3300012803 | Bacteria | 9221 |
| 75 | Ga0466706_117284 | 3300042599 | Bacteria | 1531 |
| 76 | Ga0466707_240496 | 3300042601 | Bacteria | 5172 |
| 77 | Ga0466722_157828 | 3300042609 | Bacteria | 1390 |
| 78 | Ga0466733_007063 | 3300042659 | Bacteria | 3008 |
| 79 | Ga0466733_115286 | 3300042659 | Bacteria | 4189 |
| 80 | Ga0466733_122124 | 3300042659 | Bacteria | 1303 |
| 81 | IMNBL1DRAFT_c0000292 | 3300000062 | Bacteria | 43151 |
| 82 | IMNBL1DRAFT_c0047505 | 3300000062 | Bacteria | 1385 |
| 83 | JGI24705J35276_12238742 | 3300002504 | Bacteria | 49400 |
| 84 | Ga0103267_1000635 | 3300007190 | Bacteria | 9855 |
| 85 | Ga0466715_125643 | 3300042616 | Bacteria | 61230 |
| 86 | Ga0466703_396510 | 3300042636 | Bacteria | 240496 |
| 87 | Ga0466691_081589 | 3300042593 | Bacteria | 23891 |
| 88 | Ga0466696_489411 | 3300042596 | Bacteria | 1091 |
| 89 | Ga0123357_10281361 | 3300009784 | Bacteria | 1718 |
| 90 | Ga0123355_10000040 | 3300009826 | Bacteria | 126791 |
| 91 | Ga0123355_10001853 | 3300009826 | Bacteria | 29633 |
| 92 | Ga0123355_10199757 | 3300009826 | Bacteria | 2924 |
| 93 | Ga0123355_10615607 | 3300009826 | Bacteria | 1282 |
| 94 | Ga0123356_10039817 | 3300010049 | Bacteria | 4377 |
| 95 | Ga0123356_10047092 | 3300010049 | Bacteria | 4012 |
| 96 | Ga0123356_10178345 | 3300010049 | Bacteria | 2144 |
| 97 | Ga0123356_11000500 | 3300010049 | Bacteria | 1006 |
| 98 | Ga0123353_10000128 | 3300010167 | Bacteria | 91511 |
| 99 | Ga0123353_10023444 | 3300010167 | Bacteria | 9345 |
| 100 | Ga0123353_10122622 | 3300010167 | Bacteria | 4177 |
| 101 | Ga0123353_10426310 | 3300010167 | Bacteria | 1963 |
| 102 | Ga0123353_10443862 | 3300010167 | Bacteria | 1913 |
| 103 | Ga0123353_10450501 | 3300010167 | Bacteria | 1895 |
| 104 | Ga0123354_10093601 | 3300010882 | Bacteria | 4129 |
| 105 | Ga0466701_021139 | 3300042598 | Bacteria | 44212 |
| 106 | Ga0466701_079012 | 3300042598 | Bacteria | 38672 |
| 107 | Ga0466706_006823 | 3300042599 | Unclassified | 1023 |
| 108 | Ga0466706_172549 | 3300042599 | Bacteria | 3598 |
| 109 | Ga0466706_192355 | 3300042599 | Bacteria | 16143 |
| 110 | Ga0466706_233540 | 3300042599 | Bacteria | 10607 |
| 111 | Ga0466700_082757 | 3300042600 | Bacteria | 1210 |
| 112 | Ga0466714_039115 | 3300042603 | Bacteria | 1770 |
| 113 | Ga0466733_209107 | 3300042659 | Bacteria | 1196 |
| 114 | JGI24702J35022_10014347 | 3300002462 | Bacteria | 4371 |
| 115 | JGI24702J35022_10081852 | 3300002462 | Bacteria | 1749 |
| 116 | JGI24702J35022_10109256 | 3300002462 | Bacteria | 1520 |
| 117 | Ga0466711_189861 | 3300042615 | Bacteria | 40824 |
| 118 | Ga0466715_623213 | 3300042616 | Bacteria | 2137 |
| 119 | Ga0466729_008240 | 3300042621 | Bacteria | 1452 |
| 120 | Ga0466704_133399 | 3300042643 | Bacteria | 1629 |
| 121 | Ga0466692_073280 | 3300042591 | Bacteria | 28565 |
| 122 | Ga0123355_10000747 | 3300009826 | Bacteria | 44364 |
| 123 | Ga0123355_10007540 | 3300009826 | Bacteria | 16326 |
| 124 | Ga0123355_10469695 | 3300009826 | Bacteria | 1572 |
| 125 | Ga0123353_10030541 | 3300010167 | Bacteria | 8328 |
| 126 | Ga0123353_10161437 | 3300010167 | Bacteria | 3568 |
| 127 | Ga0123353_10207580 | 3300010167 | Bacteria | 3075 |
| 128 | Ga0123353_10253469 | 3300010167 | Unclassified | 2723 |
| 129 | Ga0123353_10380592 | 3300010167 | Bacteria | 2111 |
| 130 | Ga0123353_10766257 | 3300010167 | Bacteria | 1340 |
| 131 | Ga0123353_10783347 | 3300010167 | Bacteria | 1320 |
| 132 | Ga0466706_012994 | 3300042599 | Bacteria | 21941 |
| 133 | Ga0466706_081392 | 3300042599 | Bacteria | 19279 |
| 134 | Ga0466706_090134 | 3300042599 | Bacteria | 1204 |
| 135 | Ga0466706_267745 | 3300042599 | Bacteria | 3217 |
| 136 | Ga0466714_063320 | 3300042603 | Bacteria | 8042 |
| 137 | Ga0466714_072176 | 3300042603 | Bacteria | 2153 |
| 138 | Ga0466714_091032 | 3300042603 | Bacteria | 1047 |
| 139 | Ga0466721_108056 | 3300042608 | Bacteria | 144294 |
| 140 | Ga0466722_198114 | 3300042609 | Bacteria | 1954 |
| 141 | Ga0466733_080796 | 3300042659 | Bacteria | 51249 |
| 142 | 2227223328 | 2225789004 | Bacteria | 1383 |
| 143 | 2227425284 | 2225789004 | Bacteria | 1042 |
| 144 | CVPL010W_10001300 | 3300002931 | Bacteria | 54229 |
| 145 | Ga0052191_102060 | 3300003097 | Bacteria | 1169 |
| 146 | Ga0072941_1255188 | 3300005201 | Bacteria | 7861 |
| 147 | Ga0102734_1001001 | 3300007129 | Bacteria | 7222 |
| 148 | Ga0102740_1002100 | 3300007140 | Bacteria | 4715 |
| 149 | Ga0103267_1000019 | 3300007190 | Bacteria | 80290 |
| 150 | Ga0466735_203873 | 3300042624 | Bacteria | 1364 |
| 151 | Ga0466735_212298 | 3300042624 | Bacteria | 2528 |
| 152 | Ga0466709_364735 | 3300042648 | Bacteria | 4106 |
| 153 | Ga0466724_38973 | 3300042649 | Bacteria | 164403 |
| 154 | Ga0466692_170757 | 3300042591 | Bacteria | 1057 |
| 155 | Ga0466696_173768 | 3300042596 | Bacteria | 2057 |
| 156 | Ga0123355_10000432 | 3300009826 | Bacteria | 55030 |
| 157 | Ga0123355_10066814 | 3300009826 | Bacteria | 5787 |
| 158 | Ga0123355_10153628 | 3300009826 | Bacteria | 3488 |
| 159 | Ga0123355_10562473 | 3300009826 | Bacteria | 1373 |
| 160 | Ga0123355_10889869 | 3300009826 | Bacteria | 970 |
| 161 | Ga0123353_10699824 | 3300010167 | Bacteria | 1422 |
| 162 | Ga0123353_10842896 | 3300010167 | Bacteria | 1258 |
| 163 | Ga0466706_071176 | 3300042599 | Bacteria | 2263 |
| 164 | Ga0466706_148432 | 3300042599 | Bacteria | 3306 |
| 165 | Ga0466706_197273 | 3300042599 | Bacteria | 12049 |
| 166 | Ga0466700_372103 | 3300042600 | Bacteria | 1000 |
| 167 | Ga0466714_110787 | 3300042603 | Bacteria | 2577 |
| 168 | Ga0466698_150099 | 3300042610 | Bacteria | 3853 |
| 169 | Ga0466733_031123 | 3300042659 | Bacteria | 4313 |
| 170 | Ga0466733_032212 | 3300042659 | Bacteria | 2838 |
| 171 | JGI24702J35022_10007838 | 3300002462 | Bacteria | 6088 |
| 172 | JGI24705J35276_12229052 | 3300002504 | Bacteria | 3308 |
| 173 | JGI24696J40584_12955931 | 3300002834 | Bacteria | 2967 |
| 174 | Ga0068305_10097219 | 3300005083 | Bacteria | 1699 |
| 175 | Ga0105524_104408 | 3300007733 | Bacteria | 3536 |
| 176 | Ga0466711_031534 | 3300042615 | Bacteria | 7074 |
| 177 | Ga0466715_444414 | 3300042616 | Bacteria | 8170 |
| 178 | Ga0466730_008333 | 3300042625 | Bacteria | 9843 |
| 179 | Ga0466725_331479 | 3300042654 | Bacteria | 1088 |
| 180 | Ga0160467_100078 | 3300012829 | Bacteria | 146353 |
| 181 | Ga0466694_048657 | 3300042594 | Bacteria | 3280 |
| 182 | Ga0123355_10007641 | 3300009826 | Bacteria | 16233 |
| 183 | Ga0123355_10224025 | 3300009826 | Bacteria | 2699 |
| 184 | Ga0123355_10340679 | 3300009826 | Bacteria | 1998 |
| 185 | Ga0123356_10051257 | 3300010049 | Bacteria | 3839 |
| 186 | Ga0123353_10093575 | 3300010167 | Bacteria | 4843 |
| 187 | Ga0123353_10151321 | 3300010167 | Bacteria | 3705 |
| 188 | Ga0123353_10690428 | 3300010167 | Bacteria | 1435 |
| 189 | Ga0123353_10844549 | 3300010167 | Bacteria | 1256 |
| 190 | Ga0466701_069503 | 3300042598 | Bacteria | 91243 |
| 191 | Ga0466706_263245 | 3300042599 | Bacteria | 2270 |
| 192 | Ga0466700_261668 | 3300042600 | Bacteria | 3638 |
| 193 | Ga0466714_154026 | 3300042603 | Bacteria | 10048 |
| 194 | Ga0466714_162939 | 3300042603 | Bacteria | 1774 |
| 195 | Ga0466733_019879 | 3300042659 | Bacteria | 13716 |
| 196 | 2227108585 | 2225789004 | Bacteria | 37824 |
| 197 | IMNBL1DRAFT_c0000521 | 3300000062 | Bacteria | 31595 |
| 198 | JGI24695J34938_10003957 | 3300002450 | Bacteria | 9988 |
| 199 | Ga0102735_1000275 | 3300007080 | Bacteria | 14053 |
| 200 | Ga0466725_151209 | 3300042654 | Bacteria | 1161 |
| 201 | Ga0466727_029503 | 3300042655 | Bacteria | 1361 |
| 202 | Ga0415639_000127 | 3300038395 | Bacteria | 106580 |
| 203 | Ga0415639_006558 | 3300038395 | Bacteria | 5751 |
| 204 | Ga0415639_165853 | 3300038395 | Bacteria | 2010 |
| 205 | Ga0466693_005750 | 3300042592 | Bacteria | 2539 |
| 206 | Ga0466691_115759 | 3300042593 | Bacteria | 6802 |
| 207 | Ga0123355_10047320 | 3300009826 | Bacteria | 6995 |
| 208 | Ga0123355_10164448 | 3300009826 | Bacteria | 3334 |
| 209 | Ga0123356_10046695 | 3300010049 | Bacteria | 4029 |
| 210 | Ga0123353_11073692 | 3300010167 | Bacteria | 1072 |
| 211 | Ga0123354_10387050 | 3300010882 | Bacteria | 1200 |
| 212 | Ga0466706_085003 | 3300042599 | Bacteria | 195523 |
| 213 | Ga0466714_007282 | 3300042603 | Bacteria | 1066 |
| 214 | Ga0466714_100786 | 3300042603 | Bacteria | 2811 |
| 215 | Ga0466714_123810 | 3300042603 | Bacteria | 1346 |
| 216 | Ga0466714_137975 | 3300042603 | Bacteria | 1075 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00121 | TIM | Triosephosphate isomerase | 94 | 287 | 0.98 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00121 | GO:0004807 | triose-phosphate isomerase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.