Protein Family IF03363
Metagenome
Isolate
150
Members
40
Samples
142
Scaffolds
176.69
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_10863811|Ga0123353_108638112
- Length
- 209 aa
- Sequence
- MTDVRFYFSAMMILHHLFTDEPVKFYCEGDSMPTKPRKMLGDVNSPSVIALRNMIDTQSKDTIRKWCLDYAEYKMLPIFEKHCPGDTRPRSAVNAARGYLNGDVKFPVVKRIILNECHAAARELDANPAAQAAARAVGQGSAVVHTLTHSLGLYFYAAAAIAYDSAGVGAPADEYAAIAEAVCLDYTAALQAVAVENEPNPVKLKWHC*
Sample Types
Isolate
5.3%
Metagenome
94.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
50.0%
Kalotermitidae
25.0%
Unclassified
20.0%
Hodotermitidae
2.5%
Passalidae
2.5%
Taxonomy
Archaea
4
Bacteria
129
Eukaryota
0
Viruses
0
Unclassified
17
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820333861 | Unclassified Firmicutes Nt197P3bin72 | Isolate | Unclassified |
| 2 | 2820816657 | Unclassified Actinobacteria Nt197P3bin38 | Isolate | Unclassified |
| 3 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 4 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 5 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 6 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 7 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 8 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 9 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 10 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 11 | 2820849606 | Unclassified Actinobacteria Lab288P3bin39 | Isolate | Unclassified |
| 12 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 13 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 14 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 15 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 16 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 17 | 2820573558 | Unclassified Firmicutes Emb289P3bin140 | Isolate | Unclassified |
| 18 | 2820267566 | Unclassified Firmicutes Th196P3bin33 | Isolate | Unclassified |
| 19 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 20 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 21 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 22 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 23 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 24 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 25 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 26 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 27 | 2820924633 | Unclassified Actinobacteria Emb289P3bin142 | Isolate | Unclassified |
| 28 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 29 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 30 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 31 | 2820842553 | Unclassified Actinobacteria Lab288P4bin104 | Isolate | Unclassified |
| 32 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 33 | 2820811576 | Unclassified Actinobacteria Nt197P3bin53 | Isolate | Unclassified |
| 34 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 35 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 36 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 37 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 38 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 39 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 40 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_193080 | 3300042659 | Bacteria | 3408 |
| 2 | Ga0466694_054412 | 3300042594 | Bacteria | 2370 |
| 3 | Ga0466694_235442 | 3300042594 | Unclassified | 7437 |
| 4 | Ga0466694_340696 | 3300042594 | Bacteria | 1624 |
| 5 | Ga0123356_10001677 | 3300010049 | Bacteria | 24241 |
| 6 | Ga0123356_10013051 | 3300010049 | Bacteria | 8037 |
| 7 | Ga0123356_10305555 | 3300010049 | Bacteria | 1698 |
| 8 | Ga0123356_11072183 | 3300010049 | Bacteria | 975 |
| 9 | Ga0123353_10297514 | 3300010167 | Bacteria | 2466 |
| 10 | Ga0123353_10455668 | 3300010167 | Bacteria | 1881 |
| 11 | Ga0123354_10274028 | 3300010882 | Bacteria | 1654 |
| 12 | Ga0466714_159093 | 3300042603 | Bacteria | 2360 |
| 13 | Ga0466717_281682 | 3300042604 | Bacteria | 1784 |
| 14 | Ga0466719_340143 | 3300042606 | Bacteria | 5187 |
| 15 | JGI24702J35022_10022172 | 3300002462 | Bacteria | 3440 |
| 16 | JGI24705J35276_12180266 | 3300002504 | Unclassified | 1362 |
| 17 | Ga0466715_474529 | 3300042616 | Bacteria | 3751 |
| 18 | Ga0466723_264942 | 3300042618 | Bacteria | 2987 |
| 19 | Ga0466731_126272 | 3300042622 | Unclassified | 1721 |
| 20 | Ga0466702_322530 | 3300042635 | Bacteria | 1209 |
| 21 | Ga0466733_133805 | 3300042659 | Bacteria | 2057 |
| 22 | Ga0415639_050703 | 3300038395 | Bacteria | 2756 |
| 23 | Ga0466694_007780 | 3300042594 | Bacteria | 15848 |
| 24 | Ga0466694_357995 | 3300042594 | Bacteria | 1198 |
| 25 | Ga0123355_10414351 | 3300009826 | Unclassified | 1727 |
| 26 | Ga0123356_10000618 | 3300010049 | Bacteria | 39358 |
| 27 | Ga0123356_10055505 | 3300010049 | Bacteria | 3690 |
| 28 | Ga0123356_10123426 | 3300010049 | Unclassified | 2524 |
| 29 | Ga0123356_10240654 | 3300010049 | Bacteria | 1881 |
| 30 | Ga0123353_10000374 | 3300010167 | Bacteria | 54815 |
| 31 | Ga0123353_10419045 | 3300010167 | Bacteria | 1985 |
| 32 | Ga0123353_10474485 | 3300010167 | Bacteria | 1832 |
| 33 | Ga0123353_10477064 | 3300010167 | Bacteria | 1826 |
| 34 | Ga0123353_10740095 | 3300010167 | Bacteria | 1371 |
| 35 | Ga0466705_424498 | 3300042612 | Bacteria | 2542 |
| 36 | Ga0466715_432800 | 3300042616 | Bacteria | 6273 |
| 37 | Ga0466728_118473 | 3300042620 | Bacteria | 8600 |
| 38 | Ga0466731_409473 | 3300042622 | Bacteria | 1143 |
| 39 | Ga0466694_303908 | 3300042594 | Unclassified | 1267 |
| 40 | Ga0466694_369690 | 3300042594 | Bacteria | 4407 |
| 41 | Ga0123356_10199768 | 3300010049 | Unclassified | 2038 |
| 42 | Ga0123356_11301568 | 3300010049 | Bacteria | 890 |
| 43 | Ga0123356_11848970 | 3300010049 | Bacteria | 751 |
| 44 | Ga0123353_10018913 | 3300010167 | Bacteria | 10213 |
| 45 | Ga0123353_10678124 | 3300010167 | Bacteria | 1452 |
| 46 | Ga0466714_067386 | 3300042603 | Bacteria | 1163 |
| 47 | Ga0466717_222084 | 3300042604 | Bacteria | 10688 |
| 48 | Ga0466719_277260 | 3300042606 | Bacteria | 1354 |
| 49 | JGI24702J35022_10031061 | 3300002462 | Bacteria | 2864 |
| 50 | JGI24696J40584_12951340 | 3300002834 | Bacteria | 2234 |
| 51 | Ga0466715_023052 | 3300042616 | Bacteria | 11222 |
| 52 | Ga0466715_146995 | 3300042616 | Bacteria | 1284 |
| 53 | Ga0466715_458183 | 3300042616 | Bacteria | 1461 |
| 54 | Ga0466723_175951 | 3300042618 | Bacteria | 5430 |
| 55 | Ga0466690_223605 | 3300042590 | Bacteria | 2106 |
| 56 | Ga0466694_089239 | 3300042594 | Bacteria | 21293 |
| 57 | Ga0466694_376327 | 3300042594 | Bacteria | 1143 |
| 58 | Ga0123355_11256972 | 3300009826 | Bacteria | 748 |
| 59 | Ga0123356_10101527 | 3300010049 | Bacteria | 2760 |
| 60 | Ga0123356_10200478 | 3300010049 | Bacteria | 2035 |
| 61 | Ga0123356_10266754 | 3300010049 | Bacteria | 1799 |
| 62 | Ga0123353_10208562 | 3300010167 | Bacteria | 3066 |
| 63 | Ga0123353_10361100 | 3300010167 | Bacteria | 2183 |
| 64 | Ga0123353_11213809 | 3300010167 | Bacteria | 988 |
| 65 | Ga0466701_064638 | 3300042598 | Bacteria | 1722 |
| 66 | Ga0466706_206681 | 3300042599 | Unclassified | 1360 |
| 67 | Ga0466700_154540 | 3300042600 | Bacteria | 1174 |
| 68 | Ga0466714_035741 | 3300042603 | Bacteria | 1261 |
| 69 | Ga0466717_046375 | 3300042604 | Bacteria | 6500 |
| 70 | Ga0466717_281062 | 3300042604 | Bacteria | 6947 |
| 71 | Ga0466719_163493 | 3300042606 | Bacteria | 2537 |
| 72 | Ga0466715_201706 | 3300042616 | Archaea | 3757 |
| 73 | Ga0466715_640240 | 3300042616 | Bacteria | 3005 |
| 74 | Ga0466728_390748 | 3300042620 | Bacteria | 3322 |
| 75 | Ga0466709_378399 | 3300042648 | Bacteria | 102475 |
| 76 | Ga0466694_165271 | 3300042594 | Archaea | 29459 |
| 77 | Ga0123355_10491142 | 3300009826 | Bacteria | 1521 |
| 78 | Ga0123356_10007241 | 3300010049 | Bacteria | 11091 |
| 79 | Ga0123356_10054417 | 3300010049 | Bacteria | 3727 |
| 80 | Ga0123356_10091891 | 3300010049 | Bacteria | 2894 |
| 81 | Ga0123356_10191320 | 3300010049 | Bacteria | 2077 |
| 82 | Ga0123356_10268029 | 3300010049 | Bacteria | 1796 |
| 83 | Ga0123356_11643946 | 3300010049 | Bacteria | 796 |
| 84 | Ga0123356_12845994 | 3300010049 | Bacteria | 605 |
| 85 | Ga0123353_10870660 | 3300010167 | Unclassified | 1231 |
| 86 | Ga0123353_11840853 | 3300010167 | Bacteria | 750 |
| 87 | Ga0466714_060918 | 3300042603 | Bacteria | 3277 |
| 88 | Ga0466721_078465 | 3300042608 | Unclassified | 1404 |
| 89 | JGI24702J35022_10183613 | 3300002462 | Bacteria | 1190 |
| 90 | Ga0466715_479625 | 3300042616 | Bacteria | 1003 |
| 91 | Ga0466731_307322 | 3300042622 | Bacteria | 2153 |
| 92 | Ga0466734_168780 | 3300042623 | Bacteria | 1030 |
| 93 | Ga0466702_361338 | 3300042635 | Bacteria | 1129 |
| 94 | Ga0466697_181157 | 3300042611 | Unclassified | 1460 |
| 95 | Ga0466694_028404 | 3300042594 | Bacteria | 22430 |
| 96 | Ga0466694_073495 | 3300042594 | Bacteria | 22298 |
| 97 | Ga0123355_10299916 | 3300009826 | Unclassified | 2192 |
| 98 | Ga0123355_10387885 | 3300009826 | Bacteria | 1813 |
| 99 | Ga0123356_10050925 | 3300010049 | Bacteria | 3852 |
| 100 | Ga0123356_10087084 | 3300010049 | Archaea | 2966 |
| 101 | Ga0123356_10150417 | 3300010049 | Bacteria | 2310 |
| 102 | Ga0123356_10415159 | 3300010049 | Bacteria | 1486 |
| 103 | Ga0123356_10718165 | 3300010049 | Bacteria | 1169 |
| 104 | Ga0123356_11161104 | 3300010049 | Bacteria | 939 |
| 105 | Ga0123356_11813655 | 3300010049 | Bacteria | 758 |
| 106 | Ga0123353_10009335 | 3300010167 | Bacteria | 13521 |
| 107 | Ga0123354_10177086 | 3300010882 | Bacteria | 2452 |
| 108 | Ga0466714_147450 | 3300042603 | Bacteria | 3848 |
| 109 | Ga0466716_089357 | 3300042605 | Bacteria | 4127 |
| 110 | Ga0466715_340509 | 3300042616 | Bacteria | 1821 |
| 111 | Ga0466702_235436 | 3300042635 | Bacteria | 3837 |
| 112 | Ga0466708_358607 | 3300042652 | Bacteria | 75843 |
| 113 | Ga0415639_058868 | 3300038395 | Bacteria | 1398 |
| 114 | Ga0466694_196383 | 3300042594 | Bacteria | 1367 |
| 115 | Ga0123356_10308828 | 3300010049 | Bacteria | 1690 |
| 116 | Ga0123353_10375507 | 3300010167 | Bacteria | 2129 |
| 117 | Ga0123353_10439934 | 3300010167 | Unclassified | 1924 |
| 118 | Ga0123353_10863811 | 3300010167 | Archaea | 1238 |
| 119 | Ga0123354_10124979 | 3300010882 | Bacteria | 3292 |
| 120 | Ga0466720_121193 | 3300042607 | Bacteria | 1866 |
| 121 | Ga0466728_283328 | 3300042620 | Bacteria | 2628 |
| 122 | Ga0466702_141675 | 3300042635 | Bacteria | 2199 |
| 123 | Ga0466704_232734 | 3300042643 | Bacteria | 1525 |
| 124 | Ga0466704_351317 | 3300042643 | Bacteria | 2476 |
| 125 | Ga0466709_230514 | 3300042648 | Bacteria | 4661 |
| 126 | Ga0466705_379174 | 3300042612 | Bacteria | 8844 |
| 127 | Ga0466690_101265 | 3300042590 | Bacteria | 3449 |
| 128 | Ga0466694_075104 | 3300042594 | Bacteria | 33181 |
| 129 | Ga0123355_10284966 | 3300009826 | Bacteria | 2275 |
| 130 | Ga0123355_10587502 | 3300009826 | Bacteria | 1328 |
| 131 | Ga0123356_10487554 | 3300010049 | Unclassified | 1387 |
| 132 | Ga0123356_10670993 | 3300010049 | Unclassified | 1204 |
| 133 | Ga0123356_11253201 | 3300010049 | Bacteria | 906 |
| 134 | Ga0123356_11420817 | 3300010049 | Bacteria | 854 |
| 135 | Ga0123356_12042393 | 3300010049 | Bacteria | 715 |
| 136 | Ga0123354_10126155 | 3300010882 | Bacteria | 3268 |
| 137 | Ga0466714_028990 | 3300042603 | Bacteria | 1903 |
| 138 | Ga0466717_027651 | 3300042604 | Unclassified | 1006 |
| 139 | Ga0466719_094629 | 3300042606 | Bacteria | 3668 |
| 140 | Ga0466719_394085 | 3300042606 | Bacteria | 6919 |
| 141 | Ga0466721_020617 | 3300042608 | Unclassified | 1089 |
| 142 | IMNBL1DRAFT_c0000238 | 3300000062 | Bacteria | 48318 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF21805 | Imm5_like | Imm-5 like putative immunity protein | 55 | 181 | 0.92 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.