Protein Family IF03361
Metagenome
Isolate
313
Members
139
Samples
238
Scaffolds
321.28
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_10859292|Ga0123353_108592921
- Length
- 371 aa
- Sequence
- MHDEADILDVSQVLSQNAGADSIPFMASGSEPQPYMAGYSDHTGLVHIDRRENSTISGRIKVASLNANRSLAAEIAKRLGCKLCDCNAGKFADGETYTSINETIRGADMYIVQPTSPPVNDNLMELLIMIDALRRASAGHINVVMPYFGYARQDRKARARDPISAKLIANLVTTAGATRVITMDLHCPQIQGFFDIPVDNLMGFPILAKYYTDKLGGALTDTVVVAPDLGSVPRGRALAERLNIPMAIIDKRRPKPNQSEVLNVIGEIRGKRVIIADDMIDTAGTLVNAAVAVENMGAGDIYACCTHAVLSGGAVTLIDRSPIKEVAVLDTVPVPEEKRIDKINVLPVADIFSEAIWRIHNGMSVSTLFI*
Sample Types
Isolate
24.0%
Metagenome
76.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
23.6%
Termitidae
19.7%
Kalotermitidae
11.0%
Apidae
7.9%
Tenebrionidae
6.3%
Formicidae
5.5%
Drosophilidae
4.7%
Rhinotermitidae
3.1%
Termopsidae
3.1%
Scarabaeidae
3.1%
Passalidae
1.6%
Blattidae
1.6%
Dytiscidae
1.6%
Ceratopogonidae
0.8%
Gomphidae
0.8%
Penaeidae
0.8%
Armadillidiidae
0.8%
Hodotermitidae
0.8%
Rhaphidophoridae
0.8%
Hydrophilidae
0.8%
Libellulidae
0.8%
Cerambycidae
0.8%
Taxonomy
Archaea
0
Bacteria
279
Eukaryota
0
Viruses
0
Unclassified
34
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2878857142 | Lactococcus lactis DmW198 | Isolate | Drosophilidae |
| 2 | 2914375287 | Culicoidibacter larvae CS-1 | Isolate | Ceratopogonidae |
| 3 | 2595698194 | Melissococcus plutonius 90.0 | Isolate | Apidae |
| 4 | 2595698195 | Melissococcus plutonius 119 | Isolate | Apidae |
| 5 | 2820263778 | Unclassified Firmicutes Th196P3bin37 | Isolate | Unclassified |
| 6 | 2820462123 | Unclassified Firmicutes Lab288P3bin129 | Isolate | Unclassified |
| 7 | 2820549969 | Unclassified Firmicutes Emb289P4bin66 | Isolate | Unclassified |
| 8 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 9 | 8007223943 | Enterococcus sp. MSG2901 | Isolate | |
| 10 | 8018750880 | Enterococcus sp. 12E11_DIV0728 12E11_DIV0728 | Isolate | |
| 11 | 8018802046 | Enterococcus sp. 7E2_DIV0204 7E2_DIV0204 | Isolate | Gomphidae |
| 12 | 2987037630 | Oecophyllibacter saccharovorans Ha5 | Isolate | Formicidae |
| 13 | 2997944163 | Streptococcus penaeicida CAIM 1838 | Isolate | Unclassified |
| 14 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 15 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 16 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 17 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 18 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 19 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 20 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 21 | 2843073756 | Oecophyllibacter saccharovorans Jb2 | Isolate | Formicidae |
| 22 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 23 | 2585428141 | Pilibacter termitis ATCC BAA-1030 | Isolate | Rhinotermitidae |
| 24 | 2595698190 | Melissococcus plutonius 21.1 | Isolate | Apidae |
| 25 | 2619619079 | Sphingomonas sp. Mn802worker | Isolate | Termitidae |
| 26 | 2627853628 | Melissococcus plutonius 82 | Isolate | Apidae |
| 27 | 2775507073 | Enterococcus sp. CR-Ec1 | Isolate | Unclassified |
| 28 | 2820093073 | Unclassified Proteobacteria Lab288P3bin233 | Isolate | Unclassified |
| 29 | 2651870343 | Fructobacillus sp. EFB-N1 | Isolate | Apidae |
| 30 | 8012939035 | Enterococcus sp. UD-01 | Isolate | Tenebrionidae |
| 31 | 8064008355 | Heyndrickxia oleronia | Isolate | Unclassified |
| 32 | 8082023105 | Niallia sp. Man26 | Isolate | Penaeidae |
| 33 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 34 | 8114544644 | Enterococcus sp. 9E7_DIV0242 9E7_DIV0242 | Isolate | |
| 35 | 2940218408 | Enterococcus sp. PF1-24 | Isolate | Blattidae |
| 36 | 2595698193 | Melissococcus plutonius B5 | Isolate | Apidae |
| 37 | 2595698196 | Melissococcus plutonius 49.3 | Isolate | Apidae |
| 38 | 2820602899 | Unclassified Firmicutes Emb289P1bin51 | Isolate | Unclassified |
| 39 | 2820416776 | Unclassified Firmicutes Lab288P3bin9 | Isolate | Unclassified |
| 40 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 41 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 42 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 43 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 44 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 45 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 46 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 47 | 8018754795 | Enterococcus sp. 12F9_DIV0723 12F9_DIV0723 | Isolate | |
| 48 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 49 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 50 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 51 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 52 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 53 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 54 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 55 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 56 | 2873593402 | Erysipelothrix sp. HDW6A | Isolate | Dytiscidae |
| 57 | 2873597894 | Erysipelothrix sp. HDW6B | Isolate | Unclassified |
| 58 | 2900804455 | Listeria sp. PSOL-1 Marseille-P4284 | Isolate | Unclassified |
| 59 | 2940261461 | Enterococcus sp. PFB1-1 | Isolate | Blattidae |
| 60 | 2896402965 | Weissella diestrammenae KACC 16890 | Isolate | Rhaphidophoridae |
| 61 | 2820324456 | Unclassified Firmicutes Nt197P3bin80 | Isolate | Unclassified |
| 62 | 2820082748 | Unclassified Proteobacteria Lab288P4bin14 | Isolate | Unclassified |
| 63 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 64 | 8108576847 | Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 | Isolate | |
| 65 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 66 | 3300007767 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut | Metagenome | Drosophilidae |
| 67 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 68 | 3300026175 | Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 | Metagenome | Formicidae |
| 69 | 3300005314 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 2 gut | Metagenome | Drosophilidae |
| 70 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 71 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 72 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 73 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 74 | 8114537524 | Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 | Isolate | |
| 75 | 2825804107 | Enterococcus durans BDGP3 | Isolate | Drosophilidae |
| 76 | 2850695442 | Lactococcus allomyrinae 1JSPR-7 | Isolate | Scarabaeidae |
| 77 | 2595698199 | Melissococcus plutonius 60 | Isolate | Apidae |
| 78 | 2820453354 | Unclassified Firmicutes Lab288P3bin172 | Isolate | Unclassified |
| 79 | 2820477775 | Unclassified Firmicutes Lab288P1bin79 | Isolate | Unclassified |
| 80 | 2820560510 | Unclassified Firmicutes Emb289P3bin72 | Isolate | Unclassified |
| 81 | 2756170272 | Convivina intestini DSM 28795 | Isolate | Unclassified |
| 82 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 83 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 84 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 85 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 86 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 87 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 88 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 89 | 8007215774 | Enterococcus sp. BWR-S5 | Isolate | Scarabaeidae |
| 90 | 8007237282 | Enterococcus sp. DIV0212c | Isolate | |
| 91 | 8018794549 | Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 | Isolate | |
| 92 | 8018798118 | Enterococcus sp. 7D2_DIV0200 7D2_DIV0200 | Isolate | |
| 93 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 94 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 95 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 96 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 97 | 8114549044 | Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 | Isolate | |
| 98 | 2834540479 | Leuconostoc citreum DmW_111 | Isolate | Drosophilidae |
| 99 | 2873595552 | Erysipelothrix sp. HDW6C | Isolate | Hydrophilidae |
| 100 | 2595698198 | Melissococcus plutonius L9 | Isolate | Apidae |
| 101 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 102 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 103 | 647533136 | Enterococcus faecalis Fly1 | Isolate | Drosophilidae |
| 104 | 8007220153 | Enterococcus sp. BWB1-3 | Isolate | Scarabaeidae |
| 105 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 106 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 107 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 108 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 109 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 110 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 111 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 112 | 8114541043 | Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 | Isolate | Libellulidae |
| 113 | 2834951433 | Brochothrix thermosphacta CD 337 | Isolate | Unclassified |
| 114 | 2837008993 | Oecophyllibacter saccharovorans Ta1 | Isolate | Formicidae |
| 115 | 2916858470 | Heyndrickxia oleronia | Isolate | Unclassified |
| 116 | 2084038013 | Anoplophora glabripennis gut microbial communities from Worchester, Massachusetts, USA - Larvae | Metagenome | Cerambycidae |
| 117 | 2595698197 | Melissococcus plutonius H6 | Isolate | Apidae |
| 118 | 2820007728 | Unclassified Synergistetes Lab288P3bin114 | Isolate | Unclassified |
| 119 | 2820294436 | Unclassified Firmicutes Th196P3bin104 | Isolate | Unclassified |
| 120 | 2820321184 | Unclassified Firmicutes Nt197P3bin86 | Isolate | Unclassified |
| 121 | 650716050 | Melissococcus plutonius ATCC 35311 | Isolate | Unclassified |
| 122 | 8007211731 | Enterococcus larvae BWM-S5 | Isolate | Scarabaeidae |
| 123 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 124 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 125 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 126 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 127 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 128 | 2873632256 | Weissella coleopterorum HDW19 | Isolate | Dytiscidae |
| 129 | 2820236043 | Unclassified Firmicutes Th196P3bin97 | Isolate | Unclassified |
| 130 | 2820323050 | Unclassified Firmicutes Nt197P3bin84 | Isolate | Unclassified |
| 131 | 2820347164 | Unclassified Firmicutes Nt197P3bin58 | Isolate | Unclassified |
| 132 | 2820471304 | Unclassified Firmicutes Lab288P1bin89 | Isolate | Unclassified |
| 133 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 134 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 135 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 136 | 8067071256 | Microbispora camponoti 2C-HV3 | Isolate | Formicidae |
| 137 | 8077780672 | Enterococcus sp. PLM3 | Isolate | Formicidae |
| 138 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 139 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_060280 | 3300042612 | Bacteria | 10440 |
| 2 | Ga0466705_318444 | 3300042612 | Bacteria | 10506 |
| 3 | Ga0466733_028383 | 3300042659 | Bacteria | 1512 |
| 4 | Ga0562377_0028 | 3300056842 | Bacteria | 766538 |
| 5 | Ga0562377_0173 | 3300056842 | Bacteria | 175219 |
| 6 | Ga0562374_0008 | 3300057007 | Bacteria | 1999653 |
| 7 | Ga0466706_046687 | 3300042599 | Bacteria | 3950 |
| 8 | Ga0466706_245369 | 3300042599 | Bacteria | 1774 |
| 9 | Ga0466700_430855 | 3300042600 | Bacteria | 48470 |
| 10 | Ga0466713_055468 | 3300042602 | Bacteria | 4159 |
| 11 | Ga0466719_370530 | 3300042606 | Unclassified | 1614 |
| 12 | Ga0466721_353933 | 3300042608 | Bacteria | 1689 |
| 13 | Ga0466710_257442 | 3300042613 | Bacteria | 1635 |
| 14 | Ga0466715_442109 | 3300042616 | Bacteria | 8897 |
| 15 | Ga0466726_242443 | 3300042619 | Bacteria | 31237 |
| 16 | Ga0123355_10405028 | 3300009826 | Bacteria | 1756 |
| 17 | Ga0123353_10033560 | 3300010167 | Bacteria | 7995 |
| 18 | Ga0123353_10218654 | 3300010167 | Bacteria | 2982 |
| 19 | Ga0123353_10674367 | 3300010167 | Bacteria | 1457 |
| 20 | Ga0123353_10859292 | 3300010167 | Bacteria | 1242 |
| 21 | Ga0466729_206256 | 3300042621 | Bacteria | 13126 |
| 22 | Ga0466735_149704 | 3300042624 | Bacteria | 3897 |
| 23 | Ga0466703_107806 | 3300042636 | Unclassified | 27873 |
| 24 | Ga0466704_420324 | 3300042643 | Bacteria | 1278 |
| 25 | Ga0466708_346288 | 3300042652 | Bacteria | 16026 |
| 26 | Ga0466727_079443 | 3300042655 | Bacteria | 4254 |
| 27 | Ga0530661_000158 | 3300056564 | Bacteria | 60301 |
| 28 | Ga0562379_0088 | 3300056790 | Bacteria | 331945 |
| 29 | Ga0466706_051864 | 3300042599 | Bacteria | 30707 |
| 30 | Ga0466706_121821 | 3300042599 | Bacteria | 51689 |
| 31 | Ga0466706_255791 | 3300042599 | Bacteria | 3811 |
| 32 | Ga0466714_165660 | 3300042603 | Bacteria | 7778 |
| 33 | Ga0466719_332568 | 3300042606 | Unclassified | 1844 |
| 34 | Ga0466722_034381 | 3300042609 | Bacteria | 9858 |
| 35 | Ga0466705_492259 | 3300042612 | Bacteria | 4175 |
| 36 | Ga0466711_449286 | 3300042615 | Bacteria | 12313 |
| 37 | Ga0466711_517304 | 3300042615 | Bacteria | 14827 |
| 38 | Ga0466715_088661 | 3300042616 | Bacteria | 14848 |
| 39 | Ga0466715_139193 | 3300042616 | Bacteria | 4513 |
| 40 | Ga0466723_048795 | 3300042618 | Bacteria | 74467 |
| 41 | Ga0466723_219132 | 3300042618 | Bacteria | 14076 |
| 42 | Ga0123355_10639086 | 3300009826 | Unclassified | 1247 |
| 43 | Ga0123356_10226665 | 3300010049 | Bacteria | 1930 |
| 44 | Ga0123353_10014323 | 3300010167 | Bacteria | 11422 |
| 45 | Ga0123353_10038240 | 3300010167 | Bacteria | 7540 |
| 46 | Ga0123353_10057169 | 3300010167 | Bacteria | 6247 |
| 47 | Ga0466708_015529 | 3300042652 | Unclassified | 10081 |
| 48 | Ga0160467_100409 | 3300012829 | Bacteria | 43620 |
| 49 | Ga0466690_376361 | 3300042590 | Bacteria | 34543 |
| 50 | Ga0466691_226913 | 3300042593 | Bacteria | 13083 |
| 51 | Ga0466705_250595 | 3300042612 | Unclassified | 6806 |
| 52 | Ga0466733_058351 | 3300042659 | Bacteria | 3992 |
| 53 | Ga0466733_114572 | 3300042659 | Bacteria | 34312 |
| 54 | IMNBL1DRAFT_c0000229 | 3300000062 | Bacteria | 49083 |
| 55 | CVPL010L_1000942 | 3300002932 | Bacteria | 13557 |
| 56 | Ga0068305_10195941 | 3300005083 | Bacteria | 5155 |
| 57 | Ga0466706_054025 | 3300042599 | Bacteria | 59903 |
| 58 | Ga0466706_168388 | 3300042599 | Bacteria | 30638 |
| 59 | Ga0466706_228867 | 3300042599 | Bacteria | 1091 |
| 60 | Ga0466706_260778 | 3300042599 | Bacteria | 2300 |
| 61 | Ga0466700_198485 | 3300042600 | Bacteria | 27616 |
| 62 | Ga0466707_135879 | 3300042601 | Bacteria | 100541 |
| 63 | Ga0466707_162390 | 3300042601 | Bacteria | 63505 |
| 64 | Ga0466716_517679 | 3300042605 | Bacteria | 1832 |
| 65 | Ga0466715_028680 | 3300042616 | Bacteria | 7837 |
| 66 | Ga0466715_110969 | 3300042616 | Bacteria | 33576 |
| 67 | Ga0466715_628292 | 3300042616 | Bacteria | 105793 |
| 68 | Ga0466718_083911 | 3300042617 | Bacteria | 3298 |
| 69 | Ga0466723_293784 | 3300042618 | Unclassified | 4409 |
| 70 | Ga0466726_129846 | 3300042619 | Bacteria | 44575 |
| 71 | Ga0466728_070225 | 3300042620 | Bacteria | 7687 |
| 72 | Ga0123355_10235985 | 3300009826 | Bacteria | 2602 |
| 73 | Ga0123353_10027899 | 3300010167 | Bacteria | 8661 |
| 74 | Ga0123353_10096470 | 3300010167 | Bacteria | 4765 |
| 75 | Ga0466735_209438 | 3300042624 | Unclassified | 1831 |
| 76 | Ga0466709_404679 | 3300042648 | Bacteria | 105794 |
| 77 | Ga0466725_064271 | 3300042654 | Bacteria | 4061 |
| 78 | Ga0160453_100101 | 3300012814 | Bacteria | 86925 |
| 79 | Ga0466694_060775 | 3300042594 | Bacteria | 1792 |
| 80 | Ga0466694_206550 | 3300042594 | Bacteria | 2933 |
| 81 | Ga0466696_387379 | 3300042596 | Bacteria | 2649 |
| 82 | Ga0466696_412638 | 3300042596 | Bacteria | 2103 |
| 83 | Ga0466705_316709 | 3300042612 | Bacteria | 57160 |
| 84 | Ga0562379_0065 | 3300056790 | Bacteria | 449364 |
| 85 | JGI24705J35276_12215815 | 3300002504 | Bacteria | 2019 |
| 86 | Ga0068302_10070042 | 3300005071 | Bacteria | 3379 |
| 87 | Ga0068305_10134131 | 3300005083 | Bacteria | 8961 |
| 88 | Ga0072940_1404963 | 3300005200 | Bacteria | 1407 |
| 89 | Ga0466700_227419 | 3300042600 | Bacteria | 13359 |
| 90 | Ga0466717_143998 | 3300042604 | Bacteria | 1890 |
| 91 | Ga0466719_041333 | 3300042606 | Bacteria | 3676 |
| 92 | Ga0466711_038534 | 3300042615 | Bacteria | 13789 |
| 93 | Ga0466711_276026 | 3300042615 | Bacteria | 24760 |
| 94 | Ga0466726_072451 | 3300042619 | Bacteria | 17111 |
| 95 | Ga0466728_209646 | 3300042620 | Unclassified | 15912 |
| 96 | Ga0123357_10093041 | 3300009784 | Unclassified | 3920 |
| 97 | Ga0123357_10321871 | 3300009784 | Unclassified | 1526 |
| 98 | Ga0123356_10019767 | 3300010049 | Bacteria | 6382 |
| 99 | Ga0123353_10072178 | 3300010167 | Bacteria | 5547 |
| 100 | Ga0123353_10192482 | 3300010167 | Bacteria | 3218 |
| 101 | Ga0123353_10652588 | 3300010167 | Bacteria | 1489 |
| 102 | Ga0123354_10165931 | 3300010882 | Bacteria | 2596 |
| 103 | Ga0466729_287870 | 3300042621 | Bacteria | 6102 |
| 104 | Ga0466731_081000 | 3300042622 | Bacteria | 51296 |
| 105 | Ga0466731_140475 | 3300042622 | Bacteria | 3805 |
| 106 | Ga0466730_032279 | 3300042625 | Bacteria | 5809 |
| 107 | Ga0466704_293471 | 3300042643 | Bacteria | 42708 |
| 108 | Ga0466709_176638 | 3300042648 | Bacteria | 1333 |
| 109 | Ga0466709_293126 | 3300042648 | Bacteria | 3652 |
| 110 | Ga0466725_265067 | 3300042654 | Bacteria | 2011 |
| 111 | Ga0466727_024206 | 3300042655 | Bacteria | 2330 |
| 112 | Ga0466727_147347 | 3300042655 | Bacteria | 2041 |
| 113 | Ga0466727_282830 | 3300042655 | Bacteria | 11136 |
| 114 | Ga0160452_100135 | 3300012834 | Bacteria | 90577 |
| 115 | Ga0255572_1001208 | 3300026175 | Bacteria | 38415 |
| 116 | Ga0415639_011804 | 3300038395 | Bacteria | 5533 |
| 117 | Ga0415639_030940 | 3300038395 | Bacteria | 2390 |
| 118 | Ga0466690_193934 | 3300042590 | Unclassified | 7387 |
| 119 | Ga0466691_071027 | 3300042593 | Bacteria | 55727 |
| 120 | Ga0466691_158690 | 3300042593 | Bacteria | 23745 |
| 121 | Ga0466733_086835 | 3300042659 | Bacteria | 5289 |
| 122 | Ga0530661_001495 | 3300056564 | Unclassified | 11445 |
| 123 | Ga0562378_0004 | 3300056814 | Bacteria | 2423881 |
| 124 | Ga0562375_0057 | 3300056856 | Bacteria | 447120 |
| 125 | Ga0562375_0058 | 3300056856 | Bacteria | 444736 |
| 126 | Ga0562376_0147 | 3300056857 | Bacteria | 151611 |
| 127 | Ga0562376_0461 | 3300056857 | Bacteria | 75197 |
| 128 | Ga0562374_0303 | 3300057007 | Unclassified | 93348 |
| 129 | Ga0466716_038930 | 3300042605 | Bacteria | 3821 |
| 130 | Ga0466716_253301 | 3300042605 | Bacteria | 18544 |
| 131 | Ga0466716_338786 | 3300042605 | Unclassified | 3864 |
| 132 | Ga0466705_425359 | 3300042612 | Unclassified | 3614 |
| 133 | Ga0466711_316390 | 3300042615 | Bacteria | 9449 |
| 134 | Ga0466723_214211 | 3300042618 | Bacteria | 2250 |
| 135 | Ga0466723_350196 | 3300042618 | Bacteria | 6274 |
| 136 | Ga0466726_477580 | 3300042619 | Bacteria | 3765 |
| 137 | Ga0123355_10001607 | 3300009826 | Bacteria | 31541 |
| 138 | Ga0123355_10029956 | 3300009826 | Bacteria | 8818 |
| 139 | Ga0123355_10050998 | 3300009826 | Bacteria | 6717 |
| 140 | Ga0123354_10259946 | 3300010882 | Bacteria | 1736 |
| 141 | Ga0466734_037383 | 3300042623 | Bacteria | 6542 |
| 142 | Ga0466735_108254 | 3300042624 | Bacteria | 2975 |
| 143 | Ga0466703_101774 | 3300042636 | Unclassified | 30045 |
| 144 | Ga0466727_020548 | 3300042655 | Bacteria | 9417 |
| 145 | Ga0466690_378295 | 3300042590 | Bacteria | 1509 |
| 146 | Ga0466693_118910 | 3300042592 | Bacteria | 1457 |
| 147 | Ga0466727_352611 | 3300042655 | Bacteria | 6430 |
| 148 | Ga0466732_211684 | 3300042656 | Bacteria | 5617 |
| 149 | Ga0466733_059888 | 3300042659 | Bacteria | 3511 |
| 150 | Ga0562377_0019 | 3300056842 | Bacteria | 1067000 |
| 151 | Ga0562374_0593 | 3300057007 | Bacteria | 57144 |
| 152 | Ga0068302_10041820 | 3300005071 | Unclassified | 4362 |
| 153 | Ga0074309_1091911 | 3300005314 | Bacteria | 3029 |
| 154 | Ga0105553_1024651 | 3300007767 | Bacteria | 3713 |
| 155 | Ga0466706_272224 | 3300042599 | Bacteria | 1468 |
| 156 | Ga0466700_140722 | 3300042600 | Bacteria | 4315 |
| 157 | Ga0466707_181098 | 3300042601 | Bacteria | 18474 |
| 158 | Ga0466707_366888 | 3300042601 | Bacteria | 1798 |
| 159 | Ga0466719_016906 | 3300042606 | Bacteria | 14938 |
| 160 | Ga0123353_10504386 | 3300010167 | Unclassified | 1762 |
| 161 | Ga0466729_261638 | 3300042621 | Bacteria | 163955 |
| 162 | Ga0466731_378898 | 3300042622 | Bacteria | 1513 |
| 163 | Ga0466702_084551 | 3300042635 | Bacteria | 147089 |
| 164 | Ga0466702_183708 | 3300042635 | Bacteria | 1497 |
| 165 | Ga0466703_143543 | 3300042636 | Bacteria | 16300 |
| 166 | Ga0466708_108196 | 3300042652 | Bacteria | 52397 |
| 167 | Ga0415639_000127 | 3300038395 | Bacteria | 106580 |
| 168 | Ga0415639_013719 | 3300038395 | Bacteria | 50988 |
| 169 | Ga0415639_039976 | 3300038395 | Bacteria | 6978 |
| 170 | Ga0466690_142848 | 3300042590 | Unclassified | 26687 |
| 171 | Ga0466690_268463 | 3300042590 | Bacteria | 7689 |
| 172 | Ga0466690_296706 | 3300042590 | Bacteria | 6206 |
| 173 | Ga0466691_154321 | 3300042593 | Unclassified | 20409 |
| 174 | Ga0466691_204060 | 3300042593 | Unclassified | 3563 |
| 175 | Ga0466705_042525 | 3300042612 | Bacteria | 6827 |
| 176 | Ga0466705_249855 | 3300042612 | Bacteria | 2959 |
| 177 | Ga0466732_014332 | 3300042656 | Bacteria | 7886 |
| 178 | Ga0562377_0706 | 3300056842 | Bacteria | 47228 |
| 179 | Ga0562376_0005 | 3300056857 | Bacteria | 2173693 |
| 180 | Ga0562374_0299 | 3300057007 | Bacteria | 94609 |
| 181 | AglaG_contig22322 | 2084038013 | Bacteria | 9147 |
| 182 | 2227358554 | 2225789004 | Unclassified | 119530 |
| 183 | Ga0068302_10017192 | 3300005071 | Bacteria | 7690 |
| 184 | Ga0068302_10462574 | 3300005071 | Unclassified | 1371 |
| 185 | Ga0466706_049041 | 3300042599 | Bacteria | 5322 |
| 186 | Ga0466706_066856 | 3300042599 | Bacteria | 111854 |
| 187 | Ga0466723_159344 | 3300042618 | Bacteria | 3639 |
| 188 | Ga0466723_345917 | 3300042618 | Unclassified | 4927 |
| 189 | Ga0466726_353337 | 3300042619 | Bacteria | 59989 |
| 190 | Ga0123357_10234472 | 3300009784 | Bacteria | 2002 |
| 191 | Ga0123355_10000200 | 3300009826 | Bacteria | 74631 |
| 192 | Ga0123355_10033149 | 3300009826 | Unclassified | 8388 |
| 193 | Ga0123355_10235456 | 3300009826 | Bacteria | 2606 |
| 194 | Ga0123356_10081523 | 3300010049 | Bacteria | 3061 |
| 195 | Ga0123356_10321052 | 3300010049 | Bacteria | 1662 |
| 196 | Ga0123353_10000260 | 3300010167 | Bacteria | 66938 |
| 197 | Ga0123353_10061591 | 3300010167 | Bacteria | 6018 |
| 198 | Ga0123353_10102205 | 3300010167 | Bacteria | 4620 |
| 199 | Ga0123353_10148381 | 3300010167 | Bacteria | 3747 |
| 200 | Ga0123353_10227841 | 3300010167 | Unclassified | 2908 |
| 201 | Ga0123353_10449988 | 3300010167 | Bacteria | 1896 |
| 202 | Ga0123354_10246858 | 3300010882 | Bacteria | 1820 |
| 203 | Ga0466702_153681 | 3300042635 | Bacteria | 43280 |
| 204 | Ga0466702_447535 | 3300042635 | Bacteria | 1230 |
| 205 | Ga0466709_132922 | 3300042648 | Unclassified | 1765 |
| 206 | Ga0466708_136666 | 3300042652 | Unclassified | 8411 |
| 207 | Ga0466708_403508 | 3300042652 | Unclassified | 7878 |
| 208 | Ga0466705_280363 | 3300042612 | Bacteria | 38880 |
| 209 | Ga0562375_0015 | 3300056856 | Bacteria | 1028412 |
| 210 | CVPL010L_1000655 | 3300002932 | Unclassified | 9631 |
| 211 | Ga0466706_069985 | 3300042599 | Bacteria | 2716 |
| 212 | Ga0466706_115331 | 3300042599 | Bacteria | 9408 |
| 213 | Ga0466700_172469 | 3300042600 | Bacteria | 3582 |
| 214 | Ga0466719_545853 | 3300042606 | Bacteria | 21808 |
| 215 | Ga0466722_125083 | 3300042609 | Bacteria | 7274 |
| 216 | Ga0466698_315416 | 3300042610 | Bacteria | 1455 |
| 217 | Ga0466715_056195 | 3300042616 | Bacteria | 38066 |
| 218 | Ga0466715_554014 | 3300042616 | Bacteria | 10702 |
| 219 | Ga0466715_578129 | 3300042616 | Unclassified | 1569 |
| 220 | Ga0466723_003143 | 3300042618 | Bacteria | 1094 |
| 221 | Ga0466726_286219 | 3300042619 | Bacteria | 10330 |
| 222 | Ga0123355_10387649 | 3300009826 | Bacteria | 1814 |
| 223 | Ga0123356_10035027 | 3300010049 | Bacteria | 4691 |
| 224 | Ga0123353_10150839 | 3300010167 | Bacteria | 3712 |
| 225 | Ga0123353_10230397 | 3300010167 | Bacteria | 2889 |
| 226 | Ga0123353_10408624 | 3300010167 | Bacteria | 2017 |
| 227 | Ga0123353_10479166 | 3300010167 | Bacteria | 1821 |
| 228 | Ga0123353_10841475 | 3300010167 | Bacteria | 1259 |
| 229 | Ga0466735_011346 | 3300042624 | Bacteria | 4391 |
| 230 | Ga0466735_025765 | 3300042624 | Bacteria | 6693 |
| 231 | Ga0466735_052733 | 3300042624 | Bacteria | 53512 |
| 232 | Ga0466730_016426 | 3300042625 | Unclassified | 1262 |
| 233 | Ga0466708_152570 | 3300042652 | Unclassified | 6548 |
| 234 | Ga0466727_346481 | 3300042655 | Bacteria | 130939 |
| 235 | Ga0415639_066725 | 3300038395 | Bacteria | 3058 |
| 236 | Ga0466692_126864 | 3300042591 | Bacteria | 3140 |
| 237 | Ga0466691_147830 | 3300042593 | Bacteria | 63482 |
| 238 | Ga0466696_288170 | 3300042596 | Bacteria | 14467 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.