Protein Family IF03353
Metagenome
Isolate
314
Members
99
Samples
278
Scaffolds
251.85
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_10710722|Ga0123353_107107221
- Length
- 288 aa
- Sequence
- MGGQGEGLHRKISRFDRYFYRRRVQTNGQIHYKIKNMLAKRIVPCLDIKDGKTVKGINFVGFRDAGDPVELGAEYSRQGADELVFLDITASHEGRKTFVDLVRKVAENVNIPFTVGGGIYELKDVDTLLNAGADKVSLNSAILRNPGLIDDIASNFGSHVLVAAIDGNLEDGRWVCYLNGGRIPTDKELFSWAKEAQERGAGEILFTSMTHDGVKEGYPNEALATLSDTLNIPVTASGGAGKMEHFKDAFISGKADAALAASVFHFGEIRIPELKKYLASEGIHIRL*
Sample Types
Isolate
11.5%
Metagenome
88.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
27.5%
Blattidae
16.5%
Unclassified
15.4%
Kalotermitidae
14.3%
Tenebrionidae
5.5%
Termopsidae
4.4%
Drosophilidae
4.4%
Passalidae
4.4%
Rhinotermitidae
3.3%
Gomphidae
1.1%
Libellulidae
1.1%
Hodotermitidae
1.1%
Formicidae
1.1%
Taxonomy
Archaea
1
Bacteria
304
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 2 | 8018802046 | Enterococcus sp. 7E2_DIV0204 7E2_DIV0204 | Isolate | Gomphidae |
| 3 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 4 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 5 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 6 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 7 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 8 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 9 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 10 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 11 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 12 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 13 | 2820566695 | Unclassified Firmicutes Emb289P3bin50 | Isolate | Unclassified |
| 14 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 15 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 16 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 17 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 18 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 19 | 8114537524 | Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 | Isolate | |
| 20 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 21 | 2898741527 | Sphingobacterium sp. xlx-73 | Isolate | |
| 22 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 23 | 2820442516 | Unclassified Firmicutes Lab288P3bin200 | Isolate | Unclassified |
| 24 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 25 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 26 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 27 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 28 | 8007237282 | Enterococcus sp. DIV0212c | Isolate | |
| 29 | 8018798118 | Enterococcus sp. 7D2_DIV0200 7D2_DIV0200 | Isolate | |
| 30 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 31 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 32 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 33 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 34 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 35 | 3300007149 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut | Metagenome | Drosophilidae |
| 36 | 8114541043 | Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 | Isolate | Libellulidae |
| 37 | 2834951433 | Brochothrix thermosphacta CD 337 | Isolate | Unclassified |
| 38 | 2896321640 | Sphingobacterium sp. xlx-130 | Isolate | |
| 39 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 40 | 2820265624 | Unclassified Firmicutes Th196P3bin36 | Isolate | Unclassified |
| 41 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 42 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 43 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 44 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 45 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 46 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 47 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 48 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 49 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 50 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 51 | 643348524 | Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 | Isolate | Unclassified |
| 52 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 53 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 54 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 55 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 56 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 57 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 58 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 59 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 60 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 61 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 62 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 63 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 64 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 65 | 2820951912 | Unclassified Acidobacteria Emb289P4bin26 | Isolate | Unclassified |
| 66 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 67 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 68 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 69 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 70 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 71 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 72 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 73 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 74 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 75 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 76 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 77 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 78 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 79 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 80 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 81 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 82 | 2896330536 | Sphingobacterium sp. xlx-96 | Isolate | |
| 83 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 84 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 85 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 86 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 87 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 88 | 8012939035 | Enterococcus sp. UD-01 | Isolate | Tenebrionidae |
| 89 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 90 | 2896350215 | Sphingobacterium sp. xlx-183 | Isolate | |
| 91 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 92 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 93 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 94 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 95 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 96 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 97 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 98 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 99 | 3300007058 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 3 gut | Metagenome | Drosophilidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466707_243595 | 3300042601 | Bacteria | 19927 |
| 2 | Ga0466714_048239 | 3300042603 | Bacteria | 109405 |
| 3 | Ga0466714_062004 | 3300042603 | Bacteria | 1707 |
| 4 | Ga0466722_091635 | 3300042609 | Bacteria | 5035 |
| 5 | Ga0466722_204114 | 3300042609 | Bacteria | 23829 |
| 6 | Ga0466698_449763 | 3300042610 | Bacteria | 1002 |
| 7 | Ga0123357_10010972 | 3300009784 | Bacteria | 11572 |
| 8 | Ga0123355_10406681 | 3300009826 | Bacteria | 1751 |
| 9 | Ga0123356_10000210 | 3300010049 | Bacteria | 68021 |
| 10 | Ga0123356_10172600 | 3300010049 | Bacteria | 2174 |
| 11 | Ga0123356_10175807 | 3300010049 | Bacteria | 2157 |
| 12 | Ga0123356_10232158 | 3300010049 | Bacteria | 1910 |
| 13 | Ga0123356_10298508 | 3300010049 | Bacteria | 1715 |
| 14 | Ga0123356_10423703 | 3300010049 | Archaea | 1474 |
| 15 | Ga0123356_10472393 | 3300010049 | Bacteria | 1406 |
| 16 | Ga0123356_10489439 | 3300010049 | Bacteria | 1384 |
| 17 | Ga0123356_11052117 | 3300010049 | Bacteria | 983 |
| 18 | Ga0123353_10028790 | 3300010167 | Bacteria | 8543 |
| 19 | Ga0123353_10699548 | 3300010167 | Bacteria | 1423 |
| 20 | Ga0123354_10006484 | 3300010882 | Bacteria | 17397 |
| 21 | Ga0466690_147886 | 3300042590 | Bacteria | 13686 |
| 22 | Ga0466690_216616 | 3300042590 | Bacteria | 1905 |
| 23 | Ga0466691_071826 | 3300042593 | Bacteria | 22585 |
| 24 | Ga0466715_058320 | 3300042616 | Bacteria | 5866 |
| 25 | Ga0466715_096303 | 3300042616 | Bacteria | 18483 |
| 26 | Ga0466729_099509 | 3300042621 | Bacteria | 1608 |
| 27 | Ga0466729_143931 | 3300042621 | Bacteria | 11316 |
| 28 | Ga0466703_151702 | 3300042636 | Bacteria | 27425 |
| 29 | Ga0466703_198952 | 3300042636 | Bacteria | 9159 |
| 30 | Ga0466703_319363 | 3300042636 | Bacteria | 11975 |
| 31 | Ga0466704_048621 | 3300042643 | Bacteria | 3757 |
| 32 | Ga0466709_295596 | 3300042648 | Bacteria | 10885 |
| 33 | IMNBGM34_c001209 | 3300000036 | Bacteria | 4847 |
| 34 | JGI24698J34947_10054383 | 3300002449 | Bacteria | 1999 |
| 35 | JGI24702J35022_10045890 | 3300002462 | Bacteria | 2328 |
| 36 | CVPL010W_10002427 | 3300002931 | Bacteria | 48318 |
| 37 | Ga0466705_191911 | 3300042612 | Bacteria | 3296 |
| 38 | Ga0562376_0088 | 3300056857 | Bacteria | 219719 |
| 39 | Ga0466701_047395 | 3300042598 | Bacteria | 4057 |
| 40 | Ga0466700_003037 | 3300042600 | Bacteria | 30141 |
| 41 | Ga0466707_129085 | 3300042601 | Bacteria | 1630 |
| 42 | Ga0466713_083056 | 3300042602 | Bacteria | 2149 |
| 43 | Ga0466717_184543 | 3300042604 | Unclassified | 1009 |
| 44 | Ga0466716_217748 | 3300042605 | Bacteria | 13442 |
| 45 | Ga0466719_545997 | 3300042606 | Bacteria | 4165 |
| 46 | Ga0466722_036334 | 3300042609 | Bacteria | 4666 |
| 47 | Ga0123357_10006387 | 3300009784 | Bacteria | 14365 |
| 48 | Ga0123357_10033439 | 3300009784 | Bacteria | 6986 |
| 49 | Ga0123355_10022363 | 3300009826 | Bacteria | 10135 |
| 50 | Ga0123356_10000242 | 3300010049 | Bacteria | 62970 |
| 51 | Ga0123356_10005549 | 3300010049 | Bacteria | 12829 |
| 52 | Ga0123356_10085804 | 3300010049 | Bacteria | 2987 |
| 53 | Ga0123356_10326485 | 3300010049 | Bacteria | 1649 |
| 54 | Ga0123353_10371978 | 3300010167 | Bacteria | 2142 |
| 55 | Ga0123353_10491138 | 3300010167 | Bacteria | 1792 |
| 56 | Ga0123353_11009090 | 3300010167 | Bacteria | 1117 |
| 57 | Ga0415639_032949 | 3300038395 | Bacteria | 17877 |
| 58 | Ga0466690_003105 | 3300042590 | Bacteria | 52820 |
| 59 | Ga0466690_221039 | 3300042590 | Bacteria | 17812 |
| 60 | Ga0466690_381813 | 3300042590 | Bacteria | 66142 |
| 61 | Ga0466696_255699 | 3300042596 | Bacteria | 21807 |
| 62 | Ga0466705_528022 | 3300042612 | Bacteria | 15235 |
| 63 | Ga0466703_098553 | 3300042636 | Bacteria | 10370 |
| 64 | Ga0466704_044023 | 3300042643 | Bacteria | 26668 |
| 65 | JGI24702J35022_10000738 | 3300002462 | Bacteria | 20126 |
| 66 | JGI24699J35502_11134000 | 3300002509 | Bacteria | 23716 |
| 67 | Ga0466697_253480 | 3300042611 | Bacteria | 3214 |
| 68 | Ga0562375_0015 | 3300056856 | Bacteria | 1028412 |
| 69 | Ga0466713_075503 | 3300042602 | Bacteria | 4869 |
| 70 | Ga0466717_197012 | 3300042604 | Bacteria | 10355 |
| 71 | Ga0466698_382854 | 3300042610 | Bacteria | 1448 |
| 72 | Ga0123356_10082955 | 3300010049 | Bacteria | 3036 |
| 73 | Ga0123356_10145716 | 3300010049 | Bacteria | 2342 |
| 74 | Ga0123356_10173410 | 3300010049 | Bacteria | 2170 |
| 75 | Ga0123356_10253343 | 3300010049 | Bacteria | 1839 |
| 76 | Ga0123356_10321699 | 3300010049 | Bacteria | 1660 |
| 77 | Ga0123356_10498013 | 3300010049 | Bacteria | 1374 |
| 78 | Ga0123353_10322080 | 3300010167 | Bacteria | 2345 |
| 79 | Ga0123354_10005281 | 3300010882 | Bacteria | 18726 |
| 80 | Ga0123354_10597797 | 3300010882 | Bacteria | 810 |
| 81 | Ga0466690_138349 | 3300042590 | Bacteria | 5833 |
| 82 | Ga0466696_058283 | 3300042596 | Bacteria | 42827 |
| 83 | Ga0466715_593195 | 3300042616 | Bacteria | 30381 |
| 84 | Ga0466727_171635 | 3300042655 | Bacteria | 4649 |
| 85 | 2227063686 | 2225789003 | Bacteria | 18025 |
| 86 | 2227521855 | 2225789004 | Bacteria | 17131 |
| 87 | IMNBL1DRAFT_c0000489 | 3300000062 | Bacteria | 33049 |
| 88 | JGI24702J35022_10000485 | 3300002462 | Bacteria | 24037 |
| 89 | JGI24702J35022_10016372 | 3300002462 | Bacteria | 4064 |
| 90 | JGI24705J35276_12215274 | 3300002504 | Bacteria | 1996 |
| 91 | JGI24699J35502_11133377 | 3300002509 | Bacteria | 10189 |
| 92 | JGI24696J40584_12938950 | 3300002834 | Bacteria | 1640 |
| 93 | Ga0104041_1035013 | 3300007106 | Bacteria | 2106 |
| 94 | Ga0123357_10001078 | 3300009784 | Bacteria | 28159 |
| 95 | Ga0466705_064830 | 3300042612 | Bacteria | 19081 |
| 96 | Ga0466733_029574 | 3300042659 | Bacteria | 3881 |
| 97 | Ga0466733_138016 | 3300042659 | Bacteria | 7924 |
| 98 | Ga0466733_184316 | 3300042659 | Bacteria | 2628 |
| 99 | Ga0466701_037152 | 3300042598 | Bacteria | 1545 |
| 100 | Ga0466700_252013 | 3300042600 | Bacteria | 17693 |
| 101 | Ga0466713_007344 | 3300042602 | Bacteria | 13469 |
| 102 | Ga0466713_042000 | 3300042602 | Bacteria | 23357 |
| 103 | Ga0466713_094733 | 3300042602 | Bacteria | 8171 |
| 104 | Ga0466717_138477 | 3300042604 | Bacteria | 1695 |
| 105 | Ga0466719_245083 | 3300042606 | Bacteria | 6306 |
| 106 | Ga0466719_405593 | 3300042606 | Bacteria | 3107 |
| 107 | Ga0466722_069017 | 3300042609 | Bacteria | 18716 |
| 108 | Ga0123356_10109416 | 3300010049 | Bacteria | 2666 |
| 109 | Ga0123353_10078999 | 3300010167 | Bacteria | 5289 |
| 110 | Ga0123353_10117619 | 3300010167 | Bacteria | 4275 |
| 111 | Ga0123353_10276989 | 3300010167 | Bacteria | 2580 |
| 112 | Ga0123353_10673787 | 3300010167 | Bacteria | 1458 |
| 113 | Ga0123353_10710722 | 3300010167 | Bacteria | 1408 |
| 114 | Ga0123354_10000047 | 3300010882 | Bacteria | 92241 |
| 115 | Ga0123354_10000328 | 3300010882 | Bacteria | 44060 |
| 116 | Ga0123354_10002448 | 3300010882 | Bacteria | 24525 |
| 117 | Ga0123354_10180576 | 3300010882 | Bacteria | 2411 |
| 118 | Ga0466657_092451 | 3300042582 | Unclassified | 1504 |
| 119 | Ga0466690_270570 | 3300042590 | Bacteria | 3700 |
| 120 | Ga0466692_062316 | 3300042591 | Bacteria | 1663 |
| 121 | Ga0466692_191126 | 3300042591 | Bacteria | 1644 |
| 122 | Ga0466693_093736 | 3300042592 | Bacteria | 3206 |
| 123 | Ga0466715_070660 | 3300042616 | Bacteria | 9155 |
| 124 | Ga0466726_327879 | 3300042619 | Bacteria | 3268 |
| 125 | Ga0466735_149350 | 3300042624 | Bacteria | 14544 |
| 126 | Ga0466704_107169 | 3300042643 | Bacteria | 11926 |
| 127 | Ga0466727_215312 | 3300042655 | Bacteria | 4563 |
| 128 | 2227606565 | 2225789004 | Bacteria | 2294 |
| 129 | IMNBL1DRAFT_c0001100 | 3300000062 | Bacteria | 20718 |
| 130 | JGI24695J34938_10109625 | 3300002450 | Bacteria | 1125 |
| 131 | JGI24702J35022_10145228 | 3300002462 | Bacteria | 1327 |
| 132 | Ga0068302_10169609 | 3300005071 | Bacteria | 2002 |
| 133 | Ga0104050_1002079 | 3300007153 | Bacteria | 10891 |
| 134 | Ga0466697_107714 | 3300042611 | Bacteria | 1572 |
| 135 | Ga0466701_037990 | 3300042598 | Bacteria | 12014 |
| 136 | Ga0466700_192757 | 3300042600 | Bacteria | 1420 |
| 137 | Ga0466707_050759 | 3300042601 | Bacteria | 5366 |
| 138 | Ga0466714_018529 | 3300042603 | Bacteria | 86040 |
| 139 | Ga0466717_057174 | 3300042604 | Unclassified | 2129 |
| 140 | Ga0466722_027463 | 3300042609 | Bacteria | 1383 |
| 141 | Ga0123357_10030758 | 3300009784 | Bacteria | 7282 |
| 142 | Ga0123357_10189477 | 3300009784 | Unclassified | 2375 |
| 143 | Ga0123356_10015847 | 3300010049 | Bacteria | 7213 |
| 144 | Ga0123356_10026054 | 3300010049 | Bacteria | 5496 |
| 145 | Ga0123356_10145613 | 3300010049 | Bacteria | 2343 |
| 146 | Ga0123356_10310317 | 3300010049 | Bacteria | 1686 |
| 147 | Ga0123356_10668657 | 3300010049 | Bacteria | 1206 |
| 148 | Ga0123356_10931233 | 3300010049 | Bacteria | 1040 |
| 149 | Ga0123353_10047690 | 3300010167 | Bacteria | 6816 |
| 150 | Ga0123353_10185411 | 3300010167 | Bacteria | 3291 |
| 151 | Ga0123353_10321393 | 3300010167 | Bacteria | 2348 |
| 152 | Ga0123353_10570127 | 3300010167 | Bacteria | 1627 |
| 153 | Ga0123354_10004885 | 3300010882 | Bacteria | 19219 |
| 154 | Ga0123354_10262374 | 3300010882 | Unclassified | 1722 |
| 155 | Ga0466691_094593 | 3300042593 | Bacteria | 62434 |
| 156 | Ga0466696_483456 | 3300042596 | Unclassified | 8223 |
| 157 | Ga0466699_183756 | 3300042597 | Bacteria | 5117 |
| 158 | Ga0466711_223085 | 3300042615 | Bacteria | 1836 |
| 159 | Ga0466715_566191 | 3300042616 | Bacteria | 17032 |
| 160 | Ga0466718_081242 | 3300042617 | Bacteria | 1731 |
| 161 | Ga0466726_145169 | 3300042619 | Bacteria | 2006 |
| 162 | Ga0466726_218603 | 3300042619 | Bacteria | 6308 |
| 163 | Ga0466726_489928 | 3300042619 | Bacteria | 5835 |
| 164 | Ga0466728_404258 | 3300042620 | Bacteria | 22281 |
| 165 | Ga0466709_020764 | 3300042648 | Bacteria | 14403 |
| 166 | Ga0466709_375890 | 3300042648 | Unclassified | 2870 |
| 167 | 2227513524 | 2225789004 | Bacteria | 18108 |
| 168 | IMNBL1DRAFT_c0024839 | 3300000062 | Bacteria | 2311 |
| 169 | Ga0104043_1093643 | 3300007058 | Unclassified | 1214 |
| 170 | Ga0466705_319150 | 3300042612 | Bacteria | 11105 |
| 171 | Ga0530661_000018 | 3300056564 | Bacteria | 232195 |
| 172 | Ga0530661_000025 | 3300056564 | Bacteria | 184613 |
| 173 | Ga0466713_145405 | 3300042602 | Bacteria | 30268 |
| 174 | Ga0466714_069781 | 3300042603 | Bacteria | 1554 |
| 175 | Ga0466717_059762 | 3300042604 | Unclassified | 1923 |
| 176 | Ga0466722_026149 | 3300042609 | Bacteria | 42543 |
| 177 | Ga0123357_10063888 | 3300009784 | Bacteria | 4922 |
| 178 | Ga0123357_10105389 | 3300009784 | Bacteria | 3617 |
| 179 | Ga0123356_10010107 | 3300010049 | Bacteria | 9280 |
| 180 | Ga0123356_10271944 | 3300010049 | Bacteria | 1785 |
| 181 | Ga0123356_10302665 | 3300010049 | Bacteria | 1704 |
| 182 | Ga0123356_10572832 | 3300010049 | Bacteria | 1292 |
| 183 | Ga0123356_10878226 | 3300010049 | Bacteria | 1068 |
| 184 | Ga0123353_10001822 | 3300010167 | Bacteria | 26231 |
| 185 | Ga0123353_10059700 | 3300010167 | Bacteria | 6116 |
| 186 | Ga0123353_10084874 | 3300010167 | Bacteria | 5098 |
| 187 | Ga0123353_10285120 | 3300010167 | Bacteria | 2533 |
| 188 | Ga0123353_11263406 | 3300010167 | Bacteria | 962 |
| 189 | Ga0123353_11271089 | 3300010167 | Bacteria | 958 |
| 190 | Ga0123354_10203287 | 3300010882 | Bacteria | 2169 |
| 191 | Ga0466696_092398 | 3300042596 | Bacteria | 31103 |
| 192 | Ga0466711_025702 | 3300042615 | Bacteria | 8443 |
| 193 | Ga0466711_289238 | 3300042615 | Bacteria | 45865 |
| 194 | Ga0466734_133897 | 3300042623 | Bacteria | 2550 |
| 195 | Ga0466735_008107 | 3300042624 | Bacteria | 13453 |
| 196 | Ga0466704_067334 | 3300042643 | Bacteria | 14559 |
| 197 | Ga0466704_130193 | 3300042643 | Bacteria | 8624 |
| 198 | Ga0466704_334341 | 3300042643 | Bacteria | 10042 |
| 199 | Ga0466727_216925 | 3300042655 | Bacteria | 1008 |
| 200 | 2227097482 | 2225789004 | Bacteria | 9675 |
| 201 | 2227546855 | 2225789004 | Bacteria | 15206 |
| 202 | IMNBL1DRAFT_c0000303 | 3300000062 | Bacteria | 41914 |
| 203 | Ga0068302_10056840 | 3300005071 | Bacteria | 5172 |
| 204 | Ga0104040_1154132 | 3300007149 | Bacteria | 1060 |
| 205 | Ga0466705_347982 | 3300042612 | Bacteria | 27347 |
| 206 | Ga0466701_079535 | 3300042598 | Bacteria | 72629 |
| 207 | Ga0466707_146743 | 3300042601 | Bacteria | 5186 |
| 208 | Ga0466707_167629 | 3300042601 | Bacteria | 52999 |
| 209 | Ga0466713_042033 | 3300042602 | Bacteria | 13325 |
| 210 | Ga0466719_491579 | 3300042606 | Bacteria | 7343 |
| 211 | Ga0466722_016134 | 3300042609 | Bacteria | 13088 |
| 212 | Ga0466722_252821 | 3300042609 | Bacteria | 235840 |
| 213 | Ga0123357_10011226 | 3300009784 | Bacteria | 11468 |
| 214 | Ga0123355_10136228 | 3300009826 | Bacteria | 3770 |
| 215 | Ga0123355_10621051 | 3300009826 | Bacteria | 1274 |
| 216 | Ga0123356_10008707 | 3300010049 | Bacteria | 10064 |
| 217 | Ga0123356_10054321 | 3300010049 | Bacteria | 3731 |
| 218 | Ga0123356_10065709 | 3300010049 | Bacteria | 3394 |
| 219 | Ga0123356_10119933 | 3300010049 | Bacteria | 2556 |
| 220 | Ga0123356_10660764 | 3300010049 | Bacteria | 1213 |
| 221 | Ga0123353_10008024 | 3300010167 | Bacteria | 14364 |
| 222 | Ga0123353_10055946 | 3300010167 | Bacteria | 6314 |
| 223 | Ga0123353_10067673 | 3300010167 | Bacteria | 5736 |
| 224 | Ga0123353_10299802 | 3300010167 | Bacteria | 2454 |
| 225 | Ga0123353_10621686 | 3300010167 | Bacteria | 1537 |
| 226 | Ga0123354_10005439 | 3300010882 | Bacteria | 18514 |
| 227 | Ga0123354_10029978 | 3300010882 | Bacteria | 8550 |
| 228 | Ga0123354_10300459 | 3300010882 | Bacteria | 1519 |
| 229 | Ga0466696_416536 | 3300042596 | Bacteria | 8864 |
| 230 | Ga0466715_223117 | 3300042616 | Bacteria | 2842 |
| 231 | Ga0466723_097479 | 3300042618 | Bacteria | 24080 |
| 232 | Ga0466723_367436 | 3300042618 | Bacteria | 4612 |
| 233 | Ga0466729_240911 | 3300042621 | Bacteria | 7463 |
| 234 | Ga0466734_154502 | 3300042623 | Bacteria | 1243 |
| 235 | Ga0466703_335745 | 3300042636 | Bacteria | 5577 |
| 236 | 2227540470 | 2225789004 | Bacteria | 2998 |
| 237 | IMNBL1DRAFT_c0001357 | 3300000062 | Bacteria | 18416 |
| 238 | IMNBL1DRAFT_c0001758 | 3300000062 | Bacteria | 15875 |
| 239 | JGI24705J35276_12224125 | 3300002504 | Bacteria | 2578 |
| 240 | JGI24699J35502_11134227 | 3300002509 | Bacteria | 76542 |
| 241 | Ga0068305_10167097 | 3300005083 | Bacteria | 4947 |
| 242 | Ga0466733_066581 | 3300042659 | Bacteria | 19447 |
| 243 | Ga0466733_120525 | 3300042659 | Bacteria | 8761 |
| 244 | Ga0562377_0028 | 3300056842 | Bacteria | 766538 |
| 245 | Ga0466706_168300 | 3300042599 | Bacteria | 28378 |
| 246 | Ga0466716_506121 | 3300042605 | Bacteria | 9655 |
| 247 | Ga0466719_515791 | 3300042606 | Bacteria | 3286 |
| 248 | Ga0466721_260002 | 3300042608 | Bacteria | 4064 |
| 249 | Ga0466722_164511 | 3300042609 | Bacteria | 4155 |
| 250 | Ga0123357_10012428 | 3300009784 | Bacteria | 10985 |
| 251 | Ga0123356_10117302 | 3300010049 | Bacteria | 2583 |
| 252 | Ga0123356_10117888 | 3300010049 | Bacteria | 2577 |
| 253 | Ga0123356_10171876 | 3300010049 | Bacteria | 2179 |
| 254 | Ga0123356_10181268 | 3300010049 | Bacteria | 2128 |
| 255 | Ga0123356_10325422 | 3300010049 | Bacteria | 1652 |
| 256 | Ga0123356_10515377 | 3300010049 | Bacteria | 1354 |
| 257 | Ga0123356_10639890 | 3300010049 | Bacteria | 1230 |
| 258 | Ga0123353_10157048 | 3300010167 | Bacteria | 3625 |
| 259 | Ga0123353_11272110 | 3300010167 | Bacteria | 958 |
| 260 | Ga0415639_063222 | 3300038395 | Bacteria | 3785 |
| 261 | Ga0466692_030052 | 3300042591 | Bacteria | 80804 |
| 262 | Ga0466692_077112 | 3300042591 | Bacteria | 18021 |
| 263 | Ga0466696_040606 | 3300042596 | Bacteria | 10155 |
| 264 | Ga0466715_079603 | 3300042616 | Bacteria | 222305 |
| 265 | Ga0466715_231386 | 3300042616 | Bacteria | 80319 |
| 266 | Ga0466723_197818 | 3300042618 | Bacteria | 8752 |
| 267 | Ga0466726_370795 | 3300042619 | Bacteria | 1691 |
| 268 | Ga0466726_373213 | 3300042619 | Bacteria | 4716 |
| 269 | Ga0466735_231182 | 3300042624 | Bacteria | 5723 |
| 270 | Ga0466703_137325 | 3300042636 | Bacteria | 11622 |
| 271 | Ga0466703_211262 | 3300042636 | Bacteria | 6984 |
| 272 | Ga0466704_184466 | 3300042643 | Bacteria | 5544 |
| 273 | Ga0466704_251441 | 3300042643 | Bacteria | 3970 |
| 274 | Ga0466704_460475 | 3300042643 | Bacteria | 4490 |
| 275 | 2227519383 | 2225789004 | Bacteria | 3369 |
| 276 | IMNBL1DRAFT_c0000345 | 3300000062 | Bacteria | 39398 |
| 277 | Ga0072941_1405559 | 3300005201 | Bacteria | 2092 |
| 278 | Ga0123357_10001255 | 3300009784 | Bacteria | 26695 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00977 | GO:0000105 | L-histidine biosynthetic process | BP |
| PF03060 | GO:0018580 | nitronate monooxygenase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.