Protein Family IF03309
Metagenome
Isolate
144
Members
58
Samples
116
Scaffolds
276.17
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_10491758|Ga0123353_104917582
- Length
- 325 aa
- Sequence
- MLNNSTIRFRQWFQPEPLAASFDARGVQRERCNQEYCFTSKLGEVGDYMLELPEAQTIARQIRETVTGRKIKNAVAASSPHGFAWYFGDPALYGDLLNGKTITGAEAYGGRPEIWAGDIRVAFGDGVNVRYYEAGAKLPAKHQFLLELDDGAAICCTVQMYGGMWAFPDGMNTEFYYTVGKEKPSPLSDEFDEAYFMSLINDDVKKLPAKAFLATEQRIPGLGNGVLQDILWSAKIHPKRKVSTLSGGDLQTLYETVKVLLSDMTAKRGRDTEKDLFGEPGGYITTMSRKNDGMPCPVCGSLIMRLAYMGGNVYVCEGCQGTGK*
Sample Types
Isolate
19.4%
Metagenome
80.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
49.1%
Unclassified
40.4%
Blattidae
1.8%
Passalidae
1.8%
Blaberidae
1.8%
Tenebrionidae
1.8%
Hodotermitidae
1.8%
Stratiomyidae
1.8%
Taxonomy
Archaea
0
Bacteria
134
Eukaryota
0
Viruses
0
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2772190893 | Unclassified Elusimicrobia Nt197P4_bin29 | Isolate | Unclassified |
| 2 | 2820639607 | Unclassified Firmicutes Cu122P5bin9 | Isolate | Unclassified |
| 3 | 2820800812 | Unclassified Actinobacteria Th196P4bin28 | Isolate | Unclassified |
| 4 | 646311952 | Sebaldella termitidis ATCC 33386 | Isolate | Unclassified |
| 5 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 6 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 7 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 8 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 9 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 10 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 11 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 12 | 2529293168 | Ruminiclostridium cellobioparum termitidis CT1112 | Isolate | Termitidae |
| 13 | 2820389254 | Unclassified Firmicutes Nc150P4bin19 | Isolate | Unclassified |
| 14 | 2820533259 | Unclassified Firmicutes Lab288P1bin140 | Isolate | Unclassified |
| 15 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 16 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 17 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 18 | 2820282995 | Unclassified Firmicutes Th196P3bin147 | Isolate | Unclassified |
| 19 | 2820344559 | Unclassified Firmicutes Nt197P3bin63 | Isolate | Unclassified |
| 20 | 2820357977 | Unclassified Firmicutes Nt197P3bin136 | Isolate | Unclassified |
| 21 | 2820426531 | Unclassified Firmicutes Lab288P3bin45 | Isolate | Unclassified |
| 22 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 23 | 2820733257 | Unclassified Chloroflexi Lab288P4bin59 | Isolate | Unclassified |
| 24 | 2820834831 | Unclassified Actinobacteria Lab288P4bin79 | Isolate | Unclassified |
| 25 | 2820840446 | Unclassified Actinobacteria Lab288P4bin17 | Isolate | Unclassified |
| 26 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 27 | 2820347164 | Unclassified Firmicutes Nt197P3bin58 | Isolate | Unclassified |
| 28 | 2820432912 | Unclassified Firmicutes Lab288P3bin219 | Isolate | Unclassified |
| 29 | 2820530790 | Unclassified Firmicutes Lab288P1bin141 | Isolate | Unclassified |
| 30 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 31 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 32 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 33 | 2820249082 | Unclassified Firmicutes Th196P3bin69 | Isolate | Unclassified |
| 34 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 35 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 36 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 37 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 38 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 39 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 40 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 41 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 42 | 2585428085 | Sporobacter termitidis DSM 10068 | Isolate | Termitidae |
| 43 | 2820854745 | Unclassified Actinobacteria Lab288P3bin234 | Isolate | Unclassified |
| 44 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 45 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 46 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 47 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 48 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 49 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 50 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 51 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 52 | 2820312173 | Unclassified Firmicutes Nt197P4bin8 | Isolate | Unclassified |
| 53 | 2820342392 | Unclassified Firmicutes Nt197P3bin64 | Isolate | Unclassified |
| 54 | 2820671341 | Unclassified Firmicutes Co191P3bin20 | Isolate | Unclassified |
| 55 | 2820803007 | Unclassified Actinobacteria Th196P3bin61 | Isolate | Unclassified |
| 56 | 2820917597 | Unclassified Actinobacteria Emb289P3bin57 | Isolate | Unclassified |
| 57 | 8030343600 | Proteiniborus sp. MB09-C3 | Isolate | Stratiomyidae |
| 58 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_195039 | 3300042659 | Bacteria | 65299 |
| 2 | Ga0466701_098801 | 3300042598 | Bacteria | 2703 |
| 3 | Ga0466706_136326 | 3300042599 | Unclassified | 2239 |
| 4 | Ga0466700_409670 | 3300042600 | Bacteria | 1260 |
| 5 | Ga0123356_10019970 | 3300010049 | Bacteria | 6347 |
| 6 | Ga0123356_10025004 | 3300010049 | Bacteria | 5612 |
| 7 | Ga0123356_10502649 | 3300010049 | Bacteria | 1368 |
| 8 | Ga0123353_10074111 | 3300010167 | Bacteria | 5472 |
| 9 | Ga0123353_10100141 | 3300010167 | Bacteria | 4670 |
| 10 | Ga0123353_10112794 | 3300010167 | Bacteria | 4377 |
| 11 | Ga0123353_10405115 | 3300010167 | Bacteria | 2028 |
| 12 | Ga0123354_10000857 | 3300010882 | Bacteria | 33765 |
| 13 | Ga0123354_10030480 | 3300010882 | Bacteria | 8471 |
| 14 | Ga0123354_10048985 | 3300010882 | Bacteria | 6414 |
| 15 | Ga0123354_10061976 | 3300010882 | Bacteria | 5513 |
| 16 | Ga0466734_053759 | 3300042623 | Unclassified | 1152 |
| 17 | Ga0466733_087265 | 3300042659 | Bacteria | 208960 |
| 18 | Ga0466714_064656 | 3300042603 | Bacteria | 4190 |
| 19 | Ga0466697_044646 | 3300042611 | Bacteria | 4054 |
| 20 | Ga0123357_10014632 | 3300009784 | Bacteria | 10250 |
| 21 | Ga0123355_10047590 | 3300009826 | Bacteria | 6973 |
| 22 | Ga0123356_10008142 | 3300010049 | Bacteria | 10438 |
| 23 | Ga0123356_10013762 | 3300010049 | Bacteria | 7792 |
| 24 | Ga0123356_10017001 | 3300010049 | Bacteria | 6926 |
| 25 | Ga0123356_10067970 | 3300010049 | Bacteria | 3337 |
| 26 | Ga0123353_10177168 | 3300010167 | Bacteria | 3380 |
| 27 | Ga0123353_10201758 | 3300010167 | Bacteria | 3128 |
| 28 | Ga0123353_10246581 | 3300010167 | Unclassified | 2771 |
| 29 | Ga0123353_10335867 | 3300010167 | Bacteria | 2285 |
| 30 | Ga0562377_0121 | 3300056842 | Bacteria | 244322 |
| 31 | Ga0466706_258094 | 3300042599 | Bacteria | 2143 |
| 32 | Ga0466714_070777 | 3300042603 | Bacteria | 6784 |
| 33 | Ga0466717_131882 | 3300042604 | Bacteria | 1211 |
| 34 | JGI24702J35022_10049405 | 3300002462 | Bacteria | 2240 |
| 35 | JGI24705J35276_12238766 | 3300002504 | Bacteria | 56189 |
| 36 | Ga0072940_1011411 | 3300005200 | Bacteria | 31407 |
| 37 | Ga0123357_10042439 | 3300009784 | Bacteria | 6185 |
| 38 | Ga0123356_10286164 | 3300010049 | Bacteria | 1746 |
| 39 | Ga0123353_10011231 | 3300010167 | Bacteria | 12603 |
| 40 | Ga0123353_10491758 | 3300010167 | Bacteria | 1791 |
| 41 | Ga0123353_11045688 | 3300010167 | Bacteria | 1091 |
| 42 | Ga0466733_202697 | 3300042659 | Bacteria | 12294 |
| 43 | Ga0466701_076424 | 3300042598 | Unclassified | 2376 |
| 44 | Ga0466714_163765 | 3300042603 | Bacteria | 1346 |
| 45 | Ga0466714_166100 | 3300042603 | Unclassified | 1172 |
| 46 | Ga0466657_134322 | 3300042582 | Bacteria | 5130 |
| 47 | Ga0466693_193461 | 3300042592 | Bacteria | 1076 |
| 48 | IMNBL1DRAFT_c0006476 | 3300000062 | Bacteria | 6388 |
| 49 | JGI24695J34938_10043447 | 3300002450 | Unclassified | 2005 |
| 50 | Ga0123357_10324608 | 3300009784 | Bacteria | 1515 |
| 51 | Ga0123355_10344156 | 3300009826 | Bacteria | 1983 |
| 52 | Ga0123356_10067006 | 3300010049 | Bacteria | 3362 |
| 53 | Ga0123353_10090197 | 3300010167 | Bacteria | 4936 |
| 54 | Ga0123353_10460443 | 3300010167 | Bacteria | 1869 |
| 55 | Ga0123353_11022437 | 3300010167 | Bacteria | 1108 |
| 56 | Ga0123354_10009896 | 3300010882 | Bacteria | 14651 |
| 57 | Ga0123354_10443157 | 3300010882 | Bacteria | 1058 |
| 58 | Ga0466697_240834 | 3300042611 | Bacteria | 1088 |
| 59 | Ga0466706_009960 | 3300042599 | Bacteria | 43307 |
| 60 | Ga0466700_464140 | 3300042600 | Bacteria | 1544 |
| 61 | Ga0466721_028542 | 3300042608 | Bacteria | 2389 |
| 62 | Ga0466657_007927 | 3300042582 | Bacteria | 7305 |
| 63 | JGI24695J34938_10005835 | 3300002450 | Bacteria | 7573 |
| 64 | Ga0123357_10052494 | 3300009784 | Bacteria | 5506 |
| 65 | Ga0123356_10769045 | 3300010049 | Bacteria | 1134 |
| 66 | Ga0123353_10055153 | 3300010167 | Bacteria | 6356 |
| 67 | Ga0123353_10084743 | 3300010167 | Bacteria | 5102 |
| 68 | Ga0123353_10161470 | 3300010167 | Bacteria | 3567 |
| 69 | Ga0123354_10003075 | 3300010882 | Bacteria | 22762 |
| 70 | Ga0123354_10014675 | 3300010882 | Bacteria | 12208 |
| 71 | Ga0466731_186212 | 3300042622 | Bacteria | 4029 |
| 72 | Ga0466731_192240 | 3300042622 | Unclassified | 2151 |
| 73 | Ga0466725_013909 | 3300042654 | Unclassified | 3827 |
| 74 | Ga0466710_284796 | 3300042613 | Bacteria | 1783 |
| 75 | Ga0466718_152384 | 3300042617 | Bacteria | 5389 |
| 76 | Ga0415639_017081 | 3300038395 | Bacteria | 18984 |
| 77 | IMNBL1DRAFT_c0002811 | 3300000062 | Bacteria | 11758 |
| 78 | JGI24702J35022_10157997 | 3300002462 | Bacteria | 1275 |
| 79 | JGI24699J35502_11127901 | 3300002509 | Bacteria | 4269 |
| 80 | Ga0123356_10117945 | 3300010049 | Bacteria | 2576 |
| 81 | Ga0123353_10000078 | 3300010167 | Bacteria | 107269 |
| 82 | Ga0123353_10009407 | 3300010167 | Bacteria | 13488 |
| 83 | Ga0123353_10466746 | 3300010167 | Bacteria | 1852 |
| 84 | Ga0123353_10527713 | 3300010167 | Bacteria | 1710 |
| 85 | Ga0123353_10740924 | 3300010167 | Unclassified | 1370 |
| 86 | Ga0123353_10866853 | 3300010167 | Bacteria | 1235 |
| 87 | Ga0123354_10101174 | 3300010882 | Bacteria | 3894 |
| 88 | Ga0123354_10195969 | 3300010882 | Bacteria | 2241 |
| 89 | Ga0123354_10308583 | 3300010882 | Bacteria | 1482 |
| 90 | Ga0466714_104586 | 3300042603 | Bacteria | 15865 |
| 91 | Ga0466721_208481 | 3300042608 | Bacteria | 1738 |
| 92 | JGI24702J35022_10000005 | 3300002462 | Bacteria | 97723 |
| 93 | Ga0072941_1002496 | 3300005201 | Bacteria | 19112 |
| 94 | Ga0072941_1313996 | 3300005201 | Bacteria | 1806 |
| 95 | Ga0123357_10021827 | 3300009784 | Bacteria | 8574 |
| 96 | Ga0123357_10023339 | 3300009784 | Bacteria | 8310 |
| 97 | Ga0123357_10330559 | 3300009784 | Bacteria | 1490 |
| 98 | Ga0123357_10357146 | 3300009784 | Bacteria | 1389 |
| 99 | Ga0123355_10001240 | 3300009826 | Bacteria | 35602 |
| 100 | Ga0123356_10014871 | 3300010049 | Bacteria | 7471 |
| 101 | Ga0123356_10049306 | 3300010049 | Bacteria | 3919 |
| 102 | Ga0123353_10082628 | 3300010167 | Bacteria | 5166 |
| 103 | Ga0123353_10411297 | 3300010167 | Bacteria | 2008 |
| 104 | Ga0123354_10275156 | 3300010882 | Unclassified | 1648 |
| 105 | Ga0466714_025830 | 3300042603 | Bacteria | 2489 |
| 106 | Ga0466717_107923 | 3300042604 | Bacteria | 5390 |
| 107 | Ga0072941_1307993 | 3300005201 | Bacteria | 4311 |
| 108 | Ga0123357_10000269 | 3300009784 | Bacteria | 49683 |
| 109 | Ga0123357_10055094 | 3300009784 | Bacteria | 5357 |
| 110 | Ga0123356_10054313 | 3300010049 | Bacteria | 3731 |
| 111 | Ga0123356_10446032 | 3300010049 | Bacteria | 1441 |
| 112 | Ga0123353_10033685 | 3300010167 | Bacteria | 7980 |
| 113 | Ga0123353_10090604 | 3300010167 | Bacteria | 4925 |
| 114 | Ga0123353_10155108 | 3300010167 | Bacteria | 3652 |
| 115 | Ga0123353_10333361 | 3300010167 | Bacteria | 2295 |
| 116 | Ga0466724_02639 | 3300042649 | Bacteria | 2803 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.