Protein Family IF03207
Metagenome
Isolate
126
Members
47
Samples
120
Scaffolds
220.87
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_10227438|Ga0123353_102274383
- Length
- 244 aa
- Sequence
- MYLPFTIKYDIMSKTNYLFWEATMDDAFILSHVDHTLLAATASWAEIEQLCTEAIENNTASVCIPPCYIGRIKKTFPNLNVCTVIGFPLGYDVVSAKAASAQAAIDDGAGELDMVINITDVKNGDFAAITAEIATLKAIAGQHILKVIIETCYLTEPEKIAMCKAVTDAGADYIKTSTGFGTAGATIEDIILFKAHIGPNVKIKAAGGIRTREDMVAYIEAGCSRLGTSSAIKILAGGKTTGY*
Sample Types
Isolate
4.8%
Metagenome
95.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
34.0%
Kalotermitidae
27.7%
Unclassified
19.1%
Passalidae
6.4%
Termopsidae
4.3%
Rhinotermitidae
4.3%
Hodotermitidae
2.1%
Armadillidiidae
2.1%
Taxonomy
Archaea
4
Bacteria
115
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 2 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 3 | 2820257794 | Unclassified Firmicutes Th196P3bin47 | Isolate | Unclassified |
| 4 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 5 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 6 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 7 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 8 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 9 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 10 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 11 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 12 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 13 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 14 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 15 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 16 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 17 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 18 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 19 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 20 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 21 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 22 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 23 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 24 | 2820512088 | Unclassified Firmicutes Lab288P1bin4 | Isolate | Unclassified |
| 25 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 26 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 27 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 28 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 29 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 30 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 31 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 32 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 33 | 2820220859 | Unclassified Firmicutes Th196P4bin59 | Isolate | Unclassified |
| 34 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 35 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 36 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 37 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 38 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 39 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 40 | 2820223845 | Unclassified Firmicutes Th196P4bin57 | Isolate | Unclassified |
| 41 | 2820318056 | Unclassified Firmicutes Nt197P3bin94 | Isolate | Unclassified |
| 42 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 43 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 44 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 45 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 46 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 47 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466728_416519 | 3300042620 | Bacteria | 3279 |
| 2 | Ga0466696_050727 | 3300042596 | Bacteria | 9606 |
| 3 | Ga0123353_10145715 | 3300010167 | Bacteria | 3787 |
| 4 | Ga0123353_10210806 | 3300010167 | Unclassified | 3047 |
| 5 | Ga0123353_10219590 | 3300010167 | Archaea | 2974 |
| 6 | Ga0123354_10331035 | 3300010882 | Bacteria | 1388 |
| 7 | Ga0466721_072332 | 3300042608 | Bacteria | 6986 |
| 8 | 2227646847 | 2225789004 | Unclassified | 10924 |
| 9 | Ga0466705_309406 | 3300042612 | Bacteria | 1218 |
| 10 | Ga0466733_209352 | 3300042659 | Bacteria | 6690 |
| 11 | Ga0466691_049270 | 3300042593 | Bacteria | 6339 |
| 12 | Ga0466691_150732 | 3300042593 | Bacteria | 2692 |
| 13 | Ga0466694_022674 | 3300042594 | Bacteria | 1132 |
| 14 | Ga0466694_355848 | 3300042594 | Bacteria | 3008 |
| 15 | Ga0123356_10029869 | 3300010049 | Bacteria | 5102 |
| 16 | Ga0123356_10037608 | 3300010049 | Bacteria | 4514 |
| 17 | Ga0123356_10129091 | 3300010049 | Bacteria | 2473 |
| 18 | Ga0123356_10631888 | 3300010049 | Bacteria | 1237 |
| 19 | Ga0123353_10541097 | 3300010167 | Bacteria | 1683 |
| 20 | Ga0123353_10606143 | 3300010167 | Bacteria | 1563 |
| 21 | Ga0123354_10160957 | 3300010882 | Archaea | 2665 |
| 22 | Ga0123354_10447715 | 3300010882 | Bacteria | 1049 |
| 23 | Ga0466729_226048 | 3300042621 | Bacteria | 2388 |
| 24 | Ga0466704_034743 | 3300042643 | Bacteria | 5765 |
| 25 | Ga0466708_379448 | 3300042652 | Bacteria | 15234 |
| 26 | JGI24702J35022_10223069 | 3300002462 | Unclassified | 1087 |
| 27 | Ga0466726_211052 | 3300042619 | Bacteria | 6208 |
| 28 | Ga0466690_172364 | 3300042590 | Bacteria | 2619 |
| 29 | Ga0123355_10274789 | 3300009826 | Bacteria | 2335 |
| 30 | Ga0123356_10478288 | 3300010049 | Bacteria | 1398 |
| 31 | Ga0123353_10227438 | 3300010167 | Bacteria | 2911 |
| 32 | Ga0123353_11219013 | 3300010167 | Bacteria | 985 |
| 33 | Ga0466730_015918 | 3300042625 | Bacteria | 2175 |
| 34 | JGI24702J35022_10000013 | 3300002462 | Bacteria | 68740 |
| 35 | Ga0068305_10000975 | 3300005083 | Bacteria | 96425 |
| 36 | Ga0466715_392342 | 3300042616 | Bacteria | 63693 |
| 37 | Ga0123357_10147022 | 3300009784 | Bacteria | 2874 |
| 38 | Ga0123355_10447564 | 3300009826 | Bacteria | 1630 |
| 39 | Ga0123356_10066737 | 3300010049 | Bacteria | 3369 |
| 40 | Ga0123353_10004835 | 3300010167 | Bacteria | 17501 |
| 41 | Ga0123353_10042245 | 3300010167 | Bacteria | 7209 |
| 42 | Ga0123354_10510722 | 3300010882 | Bacteria | 930 |
| 43 | Ga0466714_015876 | 3300042603 | Bacteria | 11383 |
| 44 | Ga0466719_301822 | 3300042606 | Bacteria | 3142 |
| 45 | Ga0466719_377776 | 3300042606 | Bacteria | 16760 |
| 46 | Ga0466731_013391 | 3300042622 | Bacteria | 2378 |
| 47 | JGI24695J34938_10000052 | 3300002450 | Bacteria | 90676 |
| 48 | JGI24702J35022_10000752 | 3300002462 | Bacteria | 20000 |
| 49 | Ga0466691_080917 | 3300042593 | Bacteria | 2854 |
| 50 | Ga0123355_10563417 | 3300009826 | Bacteria | 1371 |
| 51 | Ga0123356_10121807 | 3300010049 | Bacteria | 2539 |
| 52 | Ga0123356_10296758 | 3300010049 | Bacteria | 1719 |
| 53 | Ga0123356_10604013 | 3300010049 | Bacteria | 1262 |
| 54 | Ga0123356_10624149 | 3300010049 | Bacteria | 1244 |
| 55 | Ga0123356_10888994 | 3300010049 | Bacteria | 1062 |
| 56 | Ga0123356_11055649 | 3300010049 | Bacteria | 982 |
| 57 | Ga0123353_10790830 | 3300010167 | Unclassified | 1312 |
| 58 | Ga0123353_11473310 | 3300010167 | Bacteria | 869 |
| 59 | Ga0123354_10158156 | 3300010882 | Bacteria | 2706 |
| 60 | Ga0466707_060099 | 3300042601 | Bacteria | 5624 |
| 61 | Ga0466731_053130 | 3300042622 | Bacteria | 1631 |
| 62 | Ga0466704_430858 | 3300042643 | Bacteria | 10507 |
| 63 | Ga0466709_393885 | 3300042648 | Bacteria | 33752 |
| 64 | Ga0466708_025400 | 3300042652 | Bacteria | 5709 |
| 65 | Ga0072940_1001700 | 3300005200 | Bacteria | 7033 |
| 66 | Ga0466705_024637 | 3300042612 | Bacteria | 5373 |
| 67 | Ga0466693_045574 | 3300042592 | Bacteria | 1447 |
| 68 | Ga0466694_289933 | 3300042594 | Bacteria | 1527 |
| 69 | Ga0123356_10000446 | 3300010049 | Bacteria | 46577 |
| 70 | Ga0123356_10095149 | 3300010049 | Bacteria | 2847 |
| 71 | Ga0123353_10039244 | 3300010167 | Bacteria | 7451 |
| 72 | Ga0123353_10123418 | 3300010167 | Bacteria | 4163 |
| 73 | Ga0123353_10142185 | 3300010167 | Bacteria | 3842 |
| 74 | Ga0123353_10312223 | 3300010167 | Bacteria | 2392 |
| 75 | Ga0466707_351541 | 3300042601 | Bacteria | 1722 |
| 76 | Ga0466713_022763 | 3300042602 | Unclassified | 37805 |
| 77 | Ga0466716_130577 | 3300042605 | Bacteria | 11425 |
| 78 | Ga0466708_011557 | 3300042652 | Bacteria | 5280 |
| 79 | Ga0466727_168624 | 3300042655 | Bacteria | 1515 |
| 80 | Ga0466727_255649 | 3300042655 | Bacteria | 2882 |
| 81 | IMNBL1DRAFT_c0000036 | 3300000062 | Bacteria | 120012 |
| 82 | IMNBL1DRAFT_c0057123 | 3300000062 | Bacteria | 1193 |
| 83 | Ga0466728_460206 | 3300042620 | Bacteria | 5122 |
| 84 | Ga0160469_101976 | 3300012824 | Bacteria | 4447 |
| 85 | Ga0415639_073210 | 3300038395 | Bacteria | 2685 |
| 86 | Ga0466696_271359 | 3300042596 | Bacteria | 4888 |
| 87 | Ga0123356_10076338 | 3300010049 | Bacteria | 3158 |
| 88 | Ga0123356_10128621 | 3300010049 | Bacteria | 2477 |
| 89 | Ga0123356_10166814 | 3300010049 | Bacteria | 2207 |
| 90 | Ga0123356_10427609 | 3300010049 | Bacteria | 1468 |
| 91 | Ga0123353_10092511 | 3300010167 | Bacteria | 4872 |
| 92 | Ga0123353_10183434 | 3300010167 | Bacteria | 3311 |
| 93 | Ga0123353_10621821 | 3300010167 | Bacteria | 1537 |
| 94 | Ga0123353_10923331 | 3300010167 | Bacteria | 1185 |
| 95 | Ga0123353_11082362 | 3300010167 | Unclassified | 1067 |
| 96 | Ga0466713_146406 | 3300042602 | Bacteria | 1636 |
| 97 | Ga0466719_326392 | 3300042606 | Bacteria | 1187 |
| 98 | Ga0466704_104976 | 3300042643 | Bacteria | 8139 |
| 99 | JGI24702J35022_10140321 | 3300002462 | Archaea | 1348 |
| 100 | Ga0466705_161205 | 3300042612 | Bacteria | 3651 |
| 101 | Ga0466711_488710 | 3300042615 | Bacteria | 35901 |
| 102 | Ga0466723_224703 | 3300042618 | Bacteria | 2786 |
| 103 | Ga0466726_048894 | 3300042619 | Bacteria | 1806 |
| 104 | Ga0466728_482621 | 3300042620 | Bacteria | 1462 |
| 105 | Ga0466693_073550 | 3300042592 | Bacteria | 1128 |
| 106 | Ga0123356_10005085 | 3300010049 | Bacteria | 13485 |
| 107 | Ga0123356_10040257 | 3300010049 | Bacteria | 4354 |
| 108 | Ga0123356_10328640 | 3300010049 | Bacteria | 1645 |
| 109 | Ga0123356_10424510 | 3300010049 | Bacteria | 1472 |
| 110 | Ga0123353_10037774 | 3300010167 | Bacteria | 7578 |
| 111 | Ga0123353_10044644 | 3300010167 | Bacteria | 7027 |
| 112 | Ga0123353_11171826 | 3300010167 | Unclassified | 1012 |
| 113 | Ga0123354_10586449 | 3300010882 | Archaea | 823 |
| 114 | Ga0466706_028086 | 3300042599 | Bacteria | 4190 |
| 115 | Ga0466713_145384 | 3300042602 | Bacteria | 1202 |
| 116 | Ga0466722_134871 | 3300042609 | Bacteria | 4855 |
| 117 | Ga0466709_373148 | 3300042648 | Bacteria | 39663 |
| 118 | Ga0466727_287695 | 3300042655 | Bacteria | 1823 |
| 119 | Ga0466727_288569 | 3300042655 | Bacteria | 1237 |
| 120 | IMNBGM34_c000132 | 3300000036 | Bacteria | 21574 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01791 | DeoC | DeoC/LacD family aldolase | 33 | 220 | 0.89 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01791 | GO:0016829 | lyase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.