Protein Family IF03188

Metagenome Isolate
203 Members
74 Samples
161 Scaffolds
301.67 Avg Length

🧬 Representative Sequence

ID
3300010167|Ga0123353_10195486|Ga0123353_101954861
Length
353 aa
Sequence
VFFFKIAIYRNYHYFNIHKFLILRRKGFMSDTPINQGGGEIAAKKRAVNRGDMTKWQWTLREMRVNKFGYFMVAPFFILFLIFTVLPIILSLFFSFTIFNLLEAPKWVFLDNYIRLLLDDDIFLQAITNTFVFALVTGPISYLLSFMMAWFINELSPKMRAFVTLIFYAPSISGQVYMIWQIIFHSDQYGYANSLLMRYNFIQTPILWFQDEKYVMGLCIVVALWLSLGTSFLAFIAGLQTVDRSYYEAGAVDGIKNRWQELWYVTLPLMKNQLMFGAVMTITGSFGFGVVVTNLAGFPSINYAAHTIMHHLEDYGGMRFEMGYASAIATLLFLLMVGANLLVKRLLSKVGT*

📊 Sample Types

Isolate 20.7%
Metagenome 79.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 50.7%
Termitidae 25.4%
Blattidae 7.0%
Kalotermitidae 7.0%
Passalidae 2.8%
Hodotermitidae 1.4%
Termopsidae 1.4%
Rhinotermitidae 1.4%
Armadillidiidae 1.4%
Culicidae 1.4%

🌳 Taxonomy

Archaea 0
Bacteria 180
Eukaryota 0
Viruses 0
Unclassified 23

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820275298 Unclassified Firmicutes Th196P3bin17 Isolate Unclassified
2 2820285501 Unclassified Firmicutes Th196P3bin142 Isolate Unclassified
3 2820698910 Unclassified Firmicutes Co191P1bin64 Isolate Unclassified
4 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
5 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
6 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
7 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
8 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
9 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
10 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
11 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
12 2820257794 Unclassified Firmicutes Th196P3bin47 Isolate Unclassified
13 2820329821 Unclassified Firmicutes Nt197P3bin77 Isolate Unclassified
14 2820362221 Unclassified Firmicutes Nt197P3bin116 Isolate Unclassified
15 2820378768 Unclassified Firmicutes Nt197P1bin7 Isolate Unclassified
16 2820382897 Unclassified Firmicutes Nt197P1bin3 Isolate Unclassified
17 2820573558 Unclassified Firmicutes Emb289P3bin140 Isolate Unclassified
18 2820576413 Unclassified Firmicutes Emb289P3bin136 Isolate Unclassified
19 2820627938 Unclassified Firmicutes Emb289P1bin122 Isolate Unclassified
20 2940380068 Paenibacillus sp. PastH-2 Isolate Blattidae
21 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
22 2820385248 Unclassified Firmicutes Nt197P1bin19 Isolate Unclassified
23 2820673891 Unclassified Firmicutes Co191P3bin18 Isolate Unclassified
24 2820676843 Unclassified Firmicutes Co191P3bin17 Isolate Unclassified
25 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
26 2940406939 Paenibacillus sp. PastM-3 Isolate Blattidae
27 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
28 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
29 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
30 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
31 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
32 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
33 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
34 2820375548 Unclassified Firmicutes Nt197P1bin8 Isolate Unclassified
35 2820563109 Unclassified Firmicutes Emb289P3bin58 Isolate Unclassified
36 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
37 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
38 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
39 2820252425 Unclassified Firmicutes Th196P3bin6 Isolate Unclassified
40 2820294436 Unclassified Firmicutes Th196P3bin104 Isolate Unclassified
41 2820342392 Unclassified Firmicutes Nt197P3bin64 Isolate Unclassified
42 2820581541 Unclassified Firmicutes Emb289P3bin127 Isolate Unclassified
43 2820702360 Unclassified Firmicutes Co191P1bin4 Isolate Unclassified
44 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
45 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
46 2820244222 Unclassified Firmicutes Th196P3bin75 Isolate Unclassified
47 2820292184 Unclassified Firmicutes Th196P3bin109 Isolate Unclassified
48 2820380671 Unclassified Firmicutes Nt197P1bin4 Isolate Unclassified
49 2820566695 Unclassified Firmicutes Emb289P3bin50 Isolate Unclassified
50 2820663833 Unclassified Firmicutes Co191P3bin41 Isolate Unclassified
51 2940393498 Paenibacillus sp. PastF-2 Isolate Blattidae
52 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
53 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
54 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
55 2820442516 Unclassified Firmicutes Lab288P3bin200 Isolate Unclassified
56 2820453354 Unclassified Firmicutes Lab288P3bin172 Isolate Unclassified
57 2820551407 Unclassified Firmicutes Emb289P4bin38 Isolate Unclassified
58 2820685979 Unclassified Firmicutes Co191P1bin81 Isolate Unclassified
59 2820696217 Unclassified Firmicutes Co191P1bin66 Isolate Unclassified
60 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
61 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
62 2940400224 Paenibacillus sp. PastM-2 Isolate Blattidae
63 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
64 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
65 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
66 2820246658 Unclassified Firmicutes Th196P3bin70 Isolate Unclassified
67 2820336130 Unclassified Firmicutes Nt197P3bin70 Isolate Unclassified
68 2820444930 Unclassified Firmicutes Lab288P3bin199 Isolate Unclassified
69 2820630457 Unclassified Firmicutes Emb289P1bin119 Isolate Unclassified
70 2940386776 Paenibacillus sp. PastF-1 Isolate Blattidae
71 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
72 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
73 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
74 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123355_10000190 3300009826 Bacteria 76506
2 Ga0123356_10000114 3300010049 Bacteria 86741
3 Ga0123356_10007233 3300010049 Unclassified 11097
4 Ga0123356_10026432 3300010049 Unclassified 5448
5 Ga0123353_10195486 3300010167 Bacteria 3189
6 Ga0466706_136510 3300042599 Bacteria 24651
7 Ga0466721_108056 3300042608 Bacteria 144294
8 Ga0072941_1038376 3300005201 Bacteria 8730
9 Ga0466715_058213 3300042616 Bacteria 14182
10 Ga0160441_100204 3300012825 Bacteria 60509
11 Ga0415639_011494 3300038395 Bacteria 14810
12 Ga0415639_032195 3300038395 Bacteria 2623
13 Ga0415639_114323 3300038395 Bacteria 2662
14 Ga0123355_10000760 3300009826 Bacteria 44056
15 Ga0123355_10377894 3300009826 Bacteria 1849
16 Ga0123356_10011552 3300010049 Bacteria 8603
17 Ga0123356_10082168 3300010049 Unclassified 3049
18 Ga0123356_10087837 3300010049 Bacteria 2954
19 Ga0123356_10141007 3300010049 Bacteria 2377
20 Ga0123356_10524613 3300010049 Bacteria 1343
21 Ga0123353_10000978 3300010167 Bacteria 34989
22 Ga0123353_10018135 3300010167 Bacteria 10391
23 Ga0123353_10108322 3300010167 Bacteria 4478
24 Ga0123353_10218815 3300010167 Bacteria 2980
25 Ga0123353_10235208 3300010167 Bacteria 2852
26 Ga0123353_10634799 3300010167 Unclassified 1516
27 Ga0123353_10773063 3300010167 Unclassified 1332
28 Ga0466707_277381 3300042601 Bacteria 1896
29 Ga0466717_230021 3300042604 Bacteria 6936
30 Ga0466719_548987 3300042606 Bacteria 2905
31 JGI24695J34938_10011997 3300002450 Bacteria 4622
32 JGI24702J35022_10005533 3300002462 Bacteria 7367
33 Ga0466715_639916 3300042616 Bacteria 1391
34 Ga0415639_003739 3300038395 Bacteria 8273
35 Ga0415639_042080 3300038395 Bacteria 11675
36 Ga0415639_062075 3300038395 Bacteria 8562
37 Ga0123357_10007693 3300009784 Bacteria 13366
38 Ga0123355_10540215 3300009826 Bacteria 1415
39 Ga0123356_10000275 3300010049 Bacteria 59158
40 Ga0123356_10000601 3300010049 Bacteria 39769
41 Ga0123356_10003903 3300010049 Bacteria 15531
42 Ga0123356_10005686 3300010049 Bacteria 12665
43 Ga0123356_10013059 3300010049 Bacteria 8035
44 Ga0123356_10056508 3300010049 Bacteria 3657
45 Ga0123356_10445365 3300010049 Bacteria 1442
46 Ga0123353_10094408 3300010167 Unclassified 4819
47 Ga0123353_10381402 3300010167 Bacteria 2108
48 Ga0123353_10398040 3300010167 Bacteria 2051
49 Ga0123354_10043819 3300010882 Unclassified 6872
50 Ga0466700_116289 3300042600 Bacteria 48854
51 JGI24695J34938_10000962 3300002450 Bacteria 26249
52 Ga0415639_000737 3300038395 Bacteria 17059
53 Ga0466696_338067 3300042596 Bacteria 16653
54 Ga0123357_10042828 3300009784 Unclassified 6153
55 Ga0123355_10000117 3300009826 Bacteria 90330
56 Ga0123355_10002587 3300009826 Bacteria 25647
57 Ga0123355_10061502 3300009826 Bacteria 6063
58 Ga0123355_10065600 3300009826 Bacteria 5847
59 Ga0123355_10180208 3300009826 Bacteria 3137
60 Ga0123355_10354693 3300009826 Bacteria 1939
61 Ga0123355_10414702 3300009826 Bacteria 1726
62 Ga0123356_10001497 3300010049 Bacteria 25689
63 Ga0123356_10060598 3300010049 Bacteria 3532
64 Ga0123356_10071246 3300010049 Unclassified 3262
65 Ga0123356_10107771 3300010049 Unclassified 2685
66 Ga0123356_10432212 3300010049 Unclassified 1461
67 Ga0123353_10031649 3300010167 Bacteria 8199
68 Ga0123353_10085333 3300010167 Bacteria 5085
69 Ga0123353_10256214 3300010167 Bacteria 2706
70 Ga0466714_107372 3300042603 Bacteria 46573
71 2227552396 2225789004 Bacteria 15025
72 JGI24695J34938_10000026 3300002450 Bacteria 107874
73 JGI24703J35330_11748867 3300002501 Bacteria 67314
74 Ga0072941_1102555 3300005201 Bacteria 5964
75 Ga0466715_595109 3300042616 Unclassified 2316
76 Ga0160452_100185 3300012834 Bacteria 70494
77 Ga0415639_000912 3300038395 Bacteria 45180
78 Ga0415639_004226 3300038395 Bacteria 5160
79 Ga0415639_059534 3300038395 Bacteria 15056
80 Ga0466697_196368 3300042611 Bacteria 1623
81 Ga0123355_10001626 3300009826 Bacteria 31366
82 Ga0123355_10034355 3300009826 Bacteria 8239
83 Ga0123355_10037609 3300009826 Unclassified 7871
84 Ga0123356_10012845 3300010049 Bacteria 8107
85 Ga0123356_10026408 3300010049 Bacteria 5450
86 Ga0123356_10070343 3300010049 Bacteria 3282
87 Ga0123356_10465356 3300010049 Unclassified 1415
88 Ga0123353_10224061 3300010167 Bacteria 2937
89 Ga0123353_10609348 3300010167 Bacteria 1558
90 Ga0466700_381146 3300042600 Bacteria 1250
91 Ga0466717_157232 3300042604 Bacteria 1814
92 Ga0466716_464339 3300042605 Bacteria 6206
93 Ga0466702_139552 3300042635 Unclassified 1711
94 Ga0466702_313243 3300042635 Bacteria 34811
95 Ga0466724_69521 3300042649 Bacteria 2819
96 JGI24703J35330_11747182 3300002501 Bacteria 6287
97 JGI24703J35330_11748575 3300002501 Bacteria 20615
98 Ga0415639_001739 3300038395 Bacteria 10890
99 Ga0415639_010374 3300038395 Bacteria 15864
100 Ga0415639_016897 3300038395 Bacteria 19477
101 Ga0415639_021680 3300038395 Unclassified 3938
102 Ga0415639_023228 3300038395 Bacteria 1774
103 Ga0466693_025975 3300042592 Bacteria 1232
104 Ga0123355_10001620 3300009826 Bacteria 31445
105 Ga0123355_10034886 3300009826 Bacteria 8177
106 Ga0123356_10000423 3300010049 Bacteria 48180
107 Ga0123356_10091917 3300010049 Unclassified 2893
108 Ga0123356_10127316 3300010049 Bacteria 2488
109 Ga0123356_10466997 3300010049 Unclassified 1413
110 Ga0123353_10014233 3300010167 Bacteria 11456
111 Ga0123353_10772658 3300010167 Bacteria 1332
112 Ga0123353_10926103 3300010167 Unclassified 1182
113 Ga0466714_014566 3300042603 Bacteria 11887
114 Ga0466698_432420 3300042610 Bacteria 1669
115 IMNBL1DRAFT_c0000098 3300000062 Bacteria 77289
116 Ga0160470_100204 3300012813 Bacteria 50298
117 Ga0415639_001494 3300038395 Bacteria 9041
118 Ga0415639_019826 3300038395 Bacteria 6320
119 Ga0123355_10017717 3300009826 Bacteria 11264
120 Ga0123355_10107255 3300009826 Bacteria 4376
121 Ga0123355_10271331 3300009826 Bacteria 2356
122 Ga0123355_10372918 3300009826 Bacteria 1867
123 Ga0123356_10000586 3300010049 Bacteria 40440
124 Ga0123356_10022324 3300010049 Unclassified 5977
125 Ga0123356_10070241 3300010049 Bacteria 3284
126 Ga0123356_10134031 3300010049 Unclassified 2431
127 Ga0123356_10627371 3300010049 Bacteria 1241
128 Ga0466707_324238 3300042601 Bacteria 2717
129 Ga0466702_182711 3300042635 Bacteria 3427
130 Ga0466702_395902 3300042635 Bacteria 3041
131 JGI24703J35330_11748507 3300002501 Bacteria 18035
132 Ga0072941_1000674 3300005201 Bacteria 56929
133 Ga0160443_100742 3300012848 Bacteria 17170
134 Ga0415639_000673 3300038395 Bacteria 26844
135 Ga0415639_000998 3300038395 Bacteria 23114
136 Ga0415639_002310 3300038395 Bacteria 154573
137 Ga0415639_011648 3300038395 Bacteria 19275
138 Ga0415639_016487 3300038395 Bacteria 14420
139 Ga0415639_018699 3300038395 Bacteria 27629
140 Ga0415639_021013 3300038395 Bacteria 3434
141 Ga0415639_067707 3300038395 Bacteria 1443
142 Ga0415639_169333 3300038395 Bacteria 1982
143 Ga0466693_212725 3300042592 Unclassified 1112
144 Ga0123355_10000776 3300009826 Bacteria 43637
145 Ga0123355_10002231 3300009826 Bacteria 27356
146 Ga0123355_10003055 3300009826 Bacteria 23839
147 Ga0123355_10044997 3300009826 Bacteria 7179
148 Ga0123356_10000969 3300010049 Bacteria 31828
149 Ga0123356_10104419 3300010049 Bacteria 2724
150 Ga0123353_10001249 3300010167 Bacteria 31155
151 Ga0466700_305020 3300042600 Bacteria 1373
152 Ga0466722_065866 3300042609 Bacteria 7077
153 Ga0466704_402633 3300042643 Unclassified 5032
154 Ga0466727_333652 3300042655 Bacteria 2923
155 JGI24695J34938_10015997 3300002450 Bacteria 3830
156 Ga0415639_000720 3300038395 Bacteria 14913
157 Ga0415639_002269 3300038395 Bacteria 6397
158 Ga0415639_011940 3300038395 Bacteria 13091
159 Ga0415639_031357 3300038395 Bacteria 2181
160 Ga0415639_032388 3300038395 Bacteria 10378
161 Ga0466693_154801 3300042592 Bacteria 1328

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00528 BPD_transp_1 Binding-protein-dependent transport system inner membrane component 144 349 0.85

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.