Protein Family IF03136
Metagenome
Metatranscriptome
Isolate
127
Members
46
Samples
117
Scaffolds
122.41
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_10100476|Ga0123353_101004764
- Length
- 111 aa
- Sequence
- MVQPESRLKVADNTGAKEVGVIRIMGGSFRRSGGIGDVVVASVKSAVPGGQVKAQPTKRQDGTHIRFDDNAVVIINKEGNPIGTRIFGPVARELREKGYMKIVSLAPEVL*
Sample Types
Isolate
7.9%
Metagenome
91.3%
MAG
0.0%
Metatranscriptome
0.8%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
45.5%
Unclassified
25.0%
Kalotermitidae
22.7%
Hodotermitidae
2.3%
Termopsidae
2.3%
Passalidae
2.3%
Taxonomy
Archaea
0
Bacteria
114
Eukaryota
0
Viruses
0
Unclassified
13
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 2 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 3 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 4 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 5 | 2820332331 | Unclassified Firmicutes Nt197P3bin75 | Isolate | Unclassified |
| 6 | 2820468515 | Unclassified Firmicutes Lab288P1bin95 | Isolate | Unclassified |
| 7 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 8 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 9 | 2820171952 | Unclassified Planctomycetes Th196P3bin88 | Isolate | Unclassified |
| 10 | 2820611732 | Unclassified Firmicutes Emb289P1bin19 | Isolate | Unclassified |
| 11 | 2820476618 | Unclassified Firmicutes Lab288P1bin80 | Isolate | Unclassified |
| 12 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 13 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 14 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 15 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 16 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 17 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 18 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 19 | 2820711732 | Unclassified Firmicutes Co191P1bin26 | Isolate | Unclassified |
| 20 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 21 | 2820721785 | Unclassified Fibrobacteres Lab288P1bin58 | Isolate | Unclassified |
| 22 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 23 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 24 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 25 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 26 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 27 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 28 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 29 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 30 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 31 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 32 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 33 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 34 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 35 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 36 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 37 | 2820418027 | Unclassified Firmicutes Lab288P3bin85 | Isolate | Unclassified |
| 38 | 2820506701 | Unclassified Firmicutes Lab288P1bin46 | Isolate | Unclassified |
| 39 | 2820530071 | Unclassified Firmicutes Lab288P1bin142 | Isolate | Unclassified |
| 40 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 41 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 42 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 43 | 3300022232 | Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA | Metatranscriptome | Termitidae |
| 44 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 45 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 46 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_069828 | 3300042612 | Bacteria | 1355 |
| 2 | Ga0466701_015776 | 3300042598 | Bacteria | 1270 |
| 3 | Ga0466712_303812 | 3300042614 | Bacteria | 1995 |
| 4 | Ga0466726_351810 | 3300042619 | Unclassified | 23303 |
| 5 | Ga0123357_10485949 | 3300009784 | Bacteria | 1039 |
| 6 | Ga0123355_10046414 | 3300009826 | Bacteria | 7064 |
| 7 | Ga0123355_10162084 | 3300009826 | Bacteria | 3366 |
| 8 | Ga0123355_10278871 | 3300009826 | Bacteria | 2311 |
| 9 | Ga0123356_10014474 | 3300010049 | Bacteria | 7582 |
| 10 | Ga0123356_10624226 | 3300010049 | Bacteria | 1244 |
| 11 | Ga0123356_11695013 | 3300010049 | Unclassified | 784 |
| 12 | Ga0123356_13716086 | 3300010049 | Unclassified | 528 |
| 13 | Ga0123353_10100476 | 3300010167 | Bacteria | 4662 |
| 14 | Ga0123353_10754510 | 3300010167 | Bacteria | 1353 |
| 15 | Ga0466733_098365 | 3300042659 | Bacteria | 1451 |
| 16 | Ga0233288_1015477 | 3300022232 | Unclassified | 3534 |
| 17 | Ga0415639_127906 | 3300038395 | Bacteria | 3157 |
| 18 | Ga0466690_303646 | 3300042590 | Bacteria | 25857 |
| 19 | Ga0466711_190459 | 3300042615 | Bacteria | 3270 |
| 20 | Ga0466718_117027 | 3300042617 | Bacteria | 11959 |
| 21 | Ga0123357_10305255 | 3300009784 | Bacteria | 1600 |
| 22 | Ga0123355_10000012 | 3300009826 | Bacteria | 181780 |
| 23 | Ga0123355_10034990 | 3300009826 | Bacteria | 8164 |
| 24 | Ga0123355_10082217 | 3300009826 | Bacteria | 5138 |
| 25 | Ga0123355_11305231 | 3300009826 | Bacteria | 728 |
| 26 | Ga0123356_10422632 | 3300010049 | Bacteria | 1475 |
| 27 | Ga0123356_10721260 | 3300010049 | Bacteria | 1166 |
| 28 | Ga0123356_12292175 | 3300010049 | Bacteria | 675 |
| 29 | Ga0123353_10229228 | 3300010167 | Bacteria | 2898 |
| 30 | Ga0123353_10344821 | 3300010167 | Unclassified | 2248 |
| 31 | Ga0466703_267615 | 3300042636 | Unclassified | 2055 |
| 32 | Ga0466732_425116 | 3300042656 | Bacteria | 1381 |
| 33 | Ga0466706_094432 | 3300042599 | Bacteria | 10061 |
| 34 | Ga0466706_276565 | 3300042599 | Bacteria | 3672 |
| 35 | Ga0466714_050662 | 3300042603 | Bacteria | 1405 |
| 36 | Ga0264413_139229 | 3300024493 | Bacteria | 7210 |
| 37 | Ga0415639_004907 | 3300038395 | Bacteria | 5047 |
| 38 | Ga0466718_012714 | 3300042617 | Bacteria | 1432 |
| 39 | Ga0123355_10022600 | 3300009826 | Bacteria | 10083 |
| 40 | Ga0123355_10977705 | 3300009826 | Bacteria | 903 |
| 41 | Ga0123355_11983649 | 3300009826 | Bacteria | 540 |
| 42 | Ga0123356_10511452 | 3300010049 | Unclassified | 1358 |
| 43 | Ga0123356_11760791 | 3300010049 | Bacteria | 770 |
| 44 | Ga0123356_12078387 | 3300010049 | Bacteria | 709 |
| 45 | Ga0123353_10003191 | 3300010167 | Bacteria | 20634 |
| 46 | Ga0123353_10004749 | 3300010167 | Bacteria | 17612 |
| 47 | Ga0123353_10628371 | 3300010167 | Unclassified | 1526 |
| 48 | Ga0123353_11947230 | 3300010167 | Bacteria | 723 |
| 49 | Ga0072941_1725996 | 3300005201 | Bacteria | 562 |
| 50 | Ga0466732_241320 | 3300042656 | Bacteria | 2087 |
| 51 | Ga0415639_000389 | 3300038395 | Bacteria | 10970 |
| 52 | Ga0466712_200245 | 3300042614 | Bacteria | 2545 |
| 53 | Ga0123355_10773730 | 3300009826 | Bacteria | 1078 |
| 54 | Ga0123355_10821832 | 3300009826 | Bacteria | 1030 |
| 55 | Ga0123356_10002129 | 3300010049 | Bacteria | 21360 |
| 56 | Ga0123356_10017895 | 3300010049 | Bacteria | 6732 |
| 57 | Ga0123356_10238155 | 3300010049 | Bacteria | 1889 |
| 58 | Ga0123353_10081418 | 3300010167 | Bacteria | 5206 |
| 59 | Ga0123353_10211553 | 3300010167 | Unclassified | 3041 |
| 60 | Ga0123353_11259165 | 3300010167 | Bacteria | 965 |
| 61 | Ga0123353_13060069 | 3300010167 | Bacteria | 540 |
| 62 | Ga0074263_106907 | 3300005485 | Bacteria | 893 |
| 63 | Ga0466714_045260 | 3300042603 | Bacteria | 1097 |
| 64 | Ga0415639_040953 | 3300038395 | Bacteria | 5095 |
| 65 | Ga0123355_10029312 | 3300009826 | Bacteria | 8907 |
| 66 | Ga0123355_10141321 | 3300009826 | Bacteria | 3683 |
| 67 | Ga0123355_10548431 | 3300009826 | Bacteria | 1399 |
| 68 | Ga0123355_10684020 | 3300009826 | Bacteria | 1184 |
| 69 | Ga0123355_12042405 | 3300009826 | Bacteria | 530 |
| 70 | Ga0123353_10184965 | 3300010167 | Bacteria | 3295 |
| 71 | Ga0123353_11726893 | 3300010167 | Bacteria | 782 |
| 72 | Ga0123353_12498877 | 3300010167 | Bacteria | 614 |
| 73 | Ga0123354_10130810 | 3300010882 | Bacteria | 3171 |
| 74 | 2227483906 | 2225789004 | Bacteria | 831 |
| 75 | JGI24698J34947_10240730 | 3300002449 | Bacteria | 682 |
| 76 | Ga0466709_306877 | 3300042648 | Bacteria | 1035 |
| 77 | Ga0466700_221425 | 3300042600 | Bacteria | 3423 |
| 78 | Ga0466707_329910 | 3300042601 | Bacteria | 3613 |
| 79 | Ga0466690_196634 | 3300042590 | Bacteria | 4878 |
| 80 | Ga0466691_174142 | 3300042593 | Bacteria | 197808 |
| 81 | Ga0466728_108694 | 3300042620 | Bacteria | 3450 |
| 82 | Ga0123355_11475195 | 3300009826 | Bacteria | 666 |
| 83 | Ga0123356_10713094 | 3300010049 | Bacteria | 1172 |
| 84 | Ga0123353_10488580 | 3300010167 | Unclassified | 1799 |
| 85 | Ga0123353_11397901 | 3300010167 | Bacteria | 900 |
| 86 | JGI24695J34938_10012782 | 3300002450 | Bacteria | 4436 |
| 87 | JGI24695J34938_10042322 | 3300002450 | Bacteria | 2039 |
| 88 | JGI24702J35022_10392845 | 3300002462 | Bacteria | 836 |
| 89 | Ga0466714_140141 | 3300042603 | Bacteria | 2607 |
| 90 | Ga0466719_039540 | 3300042606 | Unclassified | 3961 |
| 91 | Ga0466690_318823 | 3300042590 | Bacteria | 2411 |
| 92 | Ga0466693_180971 | 3300042592 | Bacteria | 4344 |
| 93 | Ga0466696_023405 | 3300042596 | Bacteria | 42390 |
| 94 | Ga0466723_008641 | 3300042618 | Bacteria | 17566 |
| 95 | Ga0466726_341021 | 3300042619 | Bacteria | 8956 |
| 96 | Ga0123357_10545059 | 3300009784 | Bacteria | 929 |
| 97 | Ga0123357_10852091 | 3300009784 | Bacteria | 602 |
| 98 | Ga0123355_10568971 | 3300009826 | Bacteria | 1361 |
| 99 | Ga0123355_11184381 | 3300009826 | Bacteria | 782 |
| 100 | Ga0123356_10031620 | 3300010049 | Bacteria | 4952 |
| 101 | Ga0123356_11702508 | 3300010049 | Bacteria | 782 |
| 102 | Ga0123353_10251811 | 3300010167 | Unclassified | 2735 |
| 103 | Ga0123354_10254821 | 3300010882 | Bacteria | 1768 |
| 104 | Ga0466703_421093 | 3300042636 | Unclassified | 1546 |
| 105 | Ga0466705_089498 | 3300042612 | Bacteria | 1541 |
| 106 | Ga0466706_120617 | 3300042599 | Bacteria | 1427 |
| 107 | Ga0466700_168937 | 3300042600 | Bacteria | 1474 |
| 108 | Ga0415639_000390 | 3300038395 | Bacteria | 4520 |
| 109 | Ga0415639_006840 | 3300038395 | Bacteria | 1824 |
| 110 | Ga0466691_066147 | 3300042593 | Bacteria | 2053 |
| 111 | Ga0466696_296201 | 3300042596 | Bacteria | 26567 |
| 112 | Ga0466705_408161 | 3300042612 | Bacteria | 2872 |
| 113 | Ga0466723_345282 | 3300042618 | Bacteria | 3360 |
| 114 | Ga0123355_10018898 | 3300009826 | Bacteria | 10958 |
| 115 | Ga0123356_12622245 | 3300010049 | Bacteria | 631 |
| 116 | Ga0123353_10007862 | 3300010167 | Bacteria | 14483 |
| 117 | JGI24705J35276_12238800 | 3300002504 | Bacteria | 89074 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00238 | Ribosomal_L14 | Ribosomal protein L14p/L23e | 1 | 110 | 0.95 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.