Protein Family IF03124

Metagenome Isolate
163 Members
40 Samples
148 Scaffolds
232.13 Avg Length

🧬 Representative Sequence

ID
3300010167|Ga0123353_10089768|Ga0123353_100897685
Length
261 aa
Sequence
VAGEGSLKRSEREVSANKVKREPAVKRGDSIVAKKALVVEDDGNIAELLRLYLEKDGFTVAIAENGAAGVTEFERFGPDLVLLDLMLPILDGWGVCREIRAVSNVPIIMLTAKGETLDKVTGLEMGADDYIVKPFEIGELIARIHAVMRRFDTTGGLESKRLTFDNLIIDMDSFELLVNSKRVEAPPKEMELLFHLASSPNRVYTRNQLLDEVWGFDYFGDSRTVDVHVKRLREKLENVSDKWSLKTVWGVGYKFELLDG*

📊 Sample Types

Isolate 9.2%
Metagenome 90.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 38.5%
Unclassified 33.3%
Kalotermitidae 15.4%
Elmidae 2.6%
Hodotermitidae 2.6%
Scarabaeidae 2.6%
Passalidae 2.6%
Termopsidae 2.6%

🌳 Taxonomy

Archaea 1
Bacteria 142
Eukaryota 0
Viruses 0
Unclassified 20

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2864909992 Bacillus velezensis S00166 Isolate Elmidae
2 2820442516 Unclassified Firmicutes Lab288P3bin200 Isolate Unclassified
3 2820594669 Unclassified Firmicutes Emb289P1bin61 Isolate Unclassified
4 2820606014 Unclassified Firmicutes Emb289P1bin49 Isolate Unclassified
5 2820683647 Unclassified Firmicutes Co191P1bin82 Isolate Unclassified
6 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
7 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
8 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
9 2820620956 Unclassified Firmicutes Emb289P1bin128 Isolate Unclassified
10 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
11 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
12 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
13 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
14 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
15 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
16 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
17 2820707375 Unclassified Firmicutes Co191P1bin31 Isolate Unclassified
18 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
19 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
20 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
21 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
22 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
23 2791355481 Bacillus sp. ZY-1-1 Isolate Scarabaeidae
24 2820220859 Unclassified Firmicutes Th196P4bin59 Isolate Unclassified
25 2820282995 Unclassified Firmicutes Th196P3bin147 Isolate Unclassified
26 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
27 2820637417 Unclassified Firmicutes Emb289P1bin108 Isolate Unclassified
28 2820639607 Unclassified Firmicutes Cu122P5bin9 Isolate Unclassified
29 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
30 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
31 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
32 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
33 2820231849 Unclassified Firmicutes Th196P4bin1 Isolate Unclassified
34 2820587002 Unclassified Firmicutes Emb289P1bin94 Isolate Unclassified
35 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
36 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
37 3300012798 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG Metagenome
38 2820566695 Unclassified Firmicutes Emb289P3bin50 Isolate Unclassified
39 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
40 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466711_513819 3300042615 Bacteria 2840
2 Ga0466723_219380 3300042618 Bacteria 16058
3 Ga0123355_10032138 3300009826 Bacteria 8519
4 Ga0123356_10000210 3300010049 Bacteria 68021
5 Ga0123356_10012353 3300010049 Bacteria 8290
6 Ga0123356_10060826 3300010049 Bacteria 3526
7 Ga0123356_10084863 3300010049 Bacteria 3002
8 Ga0123356_10098792 3300010049 Unclassified 2796
9 Ga0123356_10241069 3300010049 Bacteria 1879
10 Ga0123356_10436501 3300010049 Bacteria 1455
11 Ga0123353_10024657 3300010167 Bacteria 9138
12 Ga0123353_10228189 3300010167 Bacteria 2905
13 Ga0123353_10306143 3300010167 Bacteria 2422
14 Ga0123353_10316881 3300010167 Bacteria 2369
15 Ga0123353_10825462 3300010167 Bacteria 1275
16 JGI24702J35022_10231901 3300002462 Bacteria 1068
17 Ga0466693_143430 3300042592 Bacteria 1198
18 Ga0466726_433948 3300042619 Bacteria 1485
19 Ga0123355_10086113 3300009826 Bacteria 4998
20 Ga0123355_10215569 3300009826 Bacteria 2772
21 Ga0123356_10000242 3300010049 Bacteria 62970
22 Ga0123356_10012310 3300010049 Bacteria 8307
23 Ga0123356_10015205 3300010049 Bacteria 7379
24 Ga0123356_10026961 3300010049 Bacteria 5388
25 Ga0123356_10037832 3300010049 Bacteria 4499
26 Ga0123356_10213662 3300010049 Bacteria 1980
27 Ga0123356_10432692 3300010049 Bacteria 1460
28 Ga0123356_10844494 3300010049 Unclassified 1087
29 Ga0123356_12034220 3300010049 Bacteria 717
30 Ga0123353_10064576 3300010167 Bacteria 5874
31 Ga0123353_10128333 3300010167 Bacteria 4072
32 Ga0123353_10372369 3300010167 Unclassified 2140
33 Ga0123353_10968829 3300010167 Bacteria 1148
34 Ga0123353_11466129 3300010167 Bacteria 872
35 IMNBL1DRAFT_c0025570 3300000062 Bacteria 2262
36 JGI24695J34938_10002186 3300002450 Bacteria 15258
37 JGI24695J34938_10010173 3300002450 Bacteria 5178
38 JGI24702J35022_10001023 3300002462 Bacteria 17500
39 Ga0466704_110118 3300042643 Bacteria 5015
40 Ga0466721_119479 3300042608 Bacteria 2741
41 Ga0123355_10000231 3300009826 Bacteria 71111
42 Ga0123355_10006955 3300009826 Bacteria 16847
43 Ga0123356_10000010 3300010049 Bacteria 220063
44 Ga0123356_10001392 3300010049 Bacteria 26803
45 Ga0123356_10003277 3300010049 Bacteria 17007
46 Ga0123356_11247823 3300010049 Unclassified 908
47 Ga0123353_10062080 3300010167 Bacteria 5993
48 Ga0123353_10850401 3300010167 Bacteria 1251
49 Ga0123353_11032461 3300010167 Bacteria 1100
50 Ga0123354_10085682 3300010882 Bacteria 4411
51 JGI24702J35022_10005389 3300002462 Unclassified 7486
52 JGI24702J35022_10060498 3300002462 Bacteria 2025
53 Ga0123356_10032945 3300010049 Archaea 4845
54 Ga0123356_10096985 3300010049 Bacteria 2820
55 Ga0123356_10133709 3300010049 Bacteria 2434
56 Ga0123356_10259901 3300010049 Bacteria 1819
57 Ga0123356_11590268 3300010049 Bacteria 809
58 Ga0123353_10001323 3300010167 Bacteria 30381
59 Ga0123353_10029121 3300010167 Bacteria 8503
60 Ga0123353_10070742 3300010167 Bacteria 5606
61 Ga0123353_10072578 3300010167 Bacteria 5532
62 Ga0123353_10082635 3300010167 Bacteria 5166
63 Ga0123353_10148693 3300010167 Unclassified 3742
64 Ga0123353_10161606 3300010167 Unclassified 3565
65 Ga0123353_10266044 3300010167 Bacteria 2645
66 Ga0123353_10308798 3300010167 Bacteria 2409
67 Ga0123353_10501862 3300010167 Bacteria 1768
68 Ga0160454_100043 3300012798 Bacteria 213095
69 JGI24702J35022_10000401 3300002462 Bacteria 25766
70 JGI24702J35022_10048658 3300002462 Bacteria 2257
71 JGI24702J35022_10105077 3300002462 Bacteria 1549
72 Ga0466705_009607 3300042612 Bacteria 7994
73 Ga0466704_002382 3300042643 Bacteria 10181
74 Ga0415639_035750 3300038395 Bacteria 3018
75 Ga0123356_10024977 3300010049 Bacteria 5615
76 Ga0123356_10025444 3300010049 Bacteria 5563
77 Ga0123356_10033679 3300010049 Bacteria 4790
78 Ga0123356_10035488 3300010049 Bacteria 4659
79 Ga0123356_10061927 3300010049 Bacteria 3495
80 Ga0123356_10122512 3300010049 Bacteria 2532
81 Ga0123356_10240498 3300010049 Unclassified 1881
82 Ga0123356_10445418 3300010049 Bacteria 1442
83 Ga0123356_10708718 3300010049 Bacteria 1176
84 Ga0123356_11967376 3300010049 Unclassified 729
85 Ga0123353_10106717 3300010167 Bacteria 4512
86 Ga0123353_10111461 3300010167 Unclassified 4407
87 Ga0123353_10192113 3300010167 Bacteria 3221
88 Ga0123353_10272770 3300010167 Bacteria 2604
89 Ga0123353_10552439 3300010167 Unclassified 1660
90 Ga0123353_10568817 3300010167 Bacteria 1630
91 JGI24702J35022_10000122 3300002462 Bacteria 37778
92 JGI24696J40584_12765949 3300002834 Unclassified 814
93 Ga0466702_106592 3300042635 Bacteria 4567
94 Ga0466719_206707 3300042606 Bacteria 1669
95 Ga0466699_113571 3300042597 Bacteria 1616
96 Ga0123357_10068367 3300009784 Bacteria 4726
97 Ga0123355_10000276 3300009826 Bacteria 66090
98 Ga0123356_10042177 3300010049 Bacteria 4251
99 Ga0123356_10175597 3300010049 Bacteria 2158
100 Ga0123356_10932767 3300010049 Bacteria 1039
101 Ga0123353_10008024 3300010167 Bacteria 14364
102 Ga0123353_10052014 3300010167 Bacteria 6539
103 Ga0123353_10099070 3300010167 Unclassified 4697
104 Ga0123353_10117148 3300010167 Bacteria 4285
105 Ga0123353_10659773 3300010167 Unclassified 1479
106 Ga0123353_10899894 3300010167 Bacteria 1205
107 Ga0123353_11118373 3300010167 Bacteria 1044
108 Ga0123354_10257969 3300010882 Unclassified 1749
109 IMNBL1DRAFT_c0002712 3300000062 Bacteria 12061
110 Ga0466705_385779 3300042612 Bacteria 9994
111 Ga0466702_114380 3300042635 Bacteria 1102
112 Ga0415639_016963 3300038395 Bacteria 6644
113 Ga0466715_502756 3300042616 Bacteria 95114
114 Ga0123355_10001355 3300009826 Bacteria 34038
115 Ga0123356_10005020 3300010049 Bacteria 13566
116 Ga0123356_10027221 3300010049 Unclassified 5360
117 Ga0123356_10137317 3300010049 Unclassified 2406
118 Ga0123356_10356561 3300010049 Bacteria 1588
119 Ga0123356_10434367 3300010049 Unclassified 1458
120 Ga0123356_10451247 3300010049 Bacteria 1434
121 Ga0123353_10025398 3300010167 Bacteria 9027
122 Ga0123353_10046802 3300010167 Unclassified 6877
123 Ga0123353_10089768 3300010167 Bacteria 4949
124 Ga0123353_10328227 3300010167 Bacteria 2318
125 Ga0123353_10335443 3300010167 Bacteria 2286
126 Ga0123353_10348806 3300010167 Unclassified 2231
127 Ga0123353_10534514 3300010167 Bacteria 1696
128 Ga0123353_10968375 3300010167 Bacteria 1148
129 Ga0123354_10134429 3300010882 Bacteria 3102
130 Ga0123354_10415906 3300010882 Bacteria 1122
131 Ga0466697_212342 3300042611 Bacteria 2540
132 Ga0466705_377825 3300042612 Bacteria 346954
133 Ga0466706_243536 3300042599 Bacteria 2804
134 Ga0466693_139380 3300042592 Bacteria 1494
135 Ga0466694_326182 3300042594 Bacteria 5144
136 Ga0123355_10006077 3300009826 Bacteria 17802
137 Ga0123355_10290245 3300009826 Bacteria 2245
138 Ga0123356_10011246 3300010049 Bacteria 8734
139 Ga0123356_10425028 3300010049 Bacteria 1472
140 Ga0123356_11201814 3300010049 Bacteria 924
141 Ga0123356_11273065 3300010049 Bacteria 899
142 Ga0123353_10071515 3300010167 Bacteria 5574
143 Ga0123353_10088506 3300010167 Bacteria 4987
144 Ga0123353_10472378 3300010167 Bacteria 1838
145 Ga0123353_10571017 3300010167 Bacteria 1626
146 Ga0123353_10684622 3300010167 Bacteria 1443
147 JGI24702J35022_10018635 3300002462 Bacteria 3781
148 JGI24702J35022_10367369 3300002462 Bacteria 863

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00072 Response_reg Response regulator receiver domain 37 144 0.98
PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal 181 255 0.96

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00072 GO:0000160 phosphorelay signal transduction system BP

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.