Protein Family IF03109

Metagenome Metatranscriptome Isolate
580 Members
194 Samples
462 Scaffolds
348.2 Avg Length

🧬 Representative Sequence

ID
3300010167|Ga0123353_10071451|Ga0123353_100714513
Length
406 aa
Sequence
MTKKAIFILHPVPEWLIKSFLLPVRCSASENHPYWRDTGMALIDFGGVNEQVVTRKEFPMTKARRALKNETIAVIGYGVQGPAQALNMKDNGFNVIVGQSKKYMKDWDRARKDGWIPGKTLFEIDEACKRGTVIEMLVSDAAQRTIWPEVKKHLTAGKTLYFSHGFSIAYKDLTKVVPPEDVDVVLVAPKGSGTSLRRNFLSGAGINSSFAVEQDATGKAREKCLALGIAVGSGYLFETTFQKEVFSDLTGERGILMGALAGVMEAQYDVLRKNGHSPSEAFNETVEELTESLIRLVAENGMDWMYSNCSATAQRGALDWKPKFKKAVEPVFKELYKKVADGTETKRVLSSCGKADYQEQLAKELKIIADSEMWQAGKTTRKLRPKEKAKTNAATAKGVKGRDAN*

πŸ“Š Sample Types

Isolate 20.2%
Metagenome 79.7%
MAG 0.0%
Metatranscriptome 0.2%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Blattidae 19.1%
Termitidae 16.0%
Unclassified 13.8%
Kalotermitidae 7.4%
Blaberidae 4.8%
Blattellidae 3.7%
Elmidae 3.2%
Rhinotermitidae 3.2%
Culicidae 3.2%
Apidae 3.2%
Formicidae 2.7%
Cicadellidae 2.7%
Pseudophyllodromiidae 2.1%
Passalidae 2.1%
Termopsidae 2.1%
Corydiidae 1.6%
Armadillidiidae 1.6%
Ectobiidae 1.1%
Hydrophilidae 1.1%
Anaplectidae 1.1%
Nyctiboridae 1.1%
Hodotermitidae 0.5%
Aphrophoridae 0.5%
Tenebrionidae 0.5%
Tryonicidae 0.5%
Drosophilidae 0.5%
Lamproblattidae 0.5%

🌳 Taxonomy

Archaea 0
Bacteria 540
Eukaryota 0
Viruses 0
Unclassified 40

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820768849 Unclassified Bacteroidetes Lab288P3bin194 Isolate Unclassified
2 2820774381 Unclassified Bacteroidetes Lab288P1bin37 Isolate Unclassified
3 2864923010 Elizabethkingia anophelis S00177 Isolate Elmidae
4 2922326829 Bacteroides sp. 224 Isolate Blattidae
5 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
6 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
7 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
8 2695420317 Dysgonomonas sp. HGC4 Isolate Unclassified
9 2820217359 Unclassified Kiritimatiellaeota Nt197P3bin101 Isolate Unclassified
10 3002002099 Blattabacterium cuenoti ECTONUhan Isolate Ectobiidae
11 3002004002 Blattabacterium cuenoti EUPOLsin Isolate Corydiidae
12 3002006476 Blattabacterium cuenoti GYNAcap Isolate Blaberidae
13 3002032411 Blattabacterium cuenoti POLYPHAGsp Isolate Corydiidae
14 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
15 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
16 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
17 3300009460 Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov Metagenome
18 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
19 641228484 Candidatus Sulcia muelleri GWSS Isolate Cicadellidae
20 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
21 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
22 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
23 8114076984 Elizabethkingia anophelis R26 Isolate Culicidae
24 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
25 2832343623 Apibacter adventoris wkB180 Isolate Apidae
26 2864788197 Elizabethkingia anophelis S00027 Isolate Elmidae
27 2864822740 Chryseobacterium shigense S00064 Isolate Elmidae
28 2882250448 Bizionia sp. APA-3 Isolate
29 2910949487 Dysgonomonas sp. 520 Isolate Blattidae
30 2910959314 Dysgonomonas sp. 511 Isolate Blattidae
31 2923982719 Parabacteroides sp. 52 Isolate Blattidae
32 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
33 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
34 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
35 3002024525 Blattabacterium cuenoti EPILAmay Isolate Blaberidae
36 3002026254 Blattabacterium cuenoti BALTAsp Isolate Pseudophyllodromiidae
37 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
38 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
39 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
40 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
41 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
42 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
43 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
44 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
45 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
46 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
47 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
48 646564518 Candidatus Sulcia muelleri DMIN (unscreened) Isolate Cicadellidae
49 648028014 Candidatus Sulcia muelleri CARI Isolate Unclassified
50 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
51 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
52 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
53 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
54 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
55 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
56 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
57 2864948220 Elizabethkingia anophelis S00205 Isolate Elmidae
58 2609459943 Bacteroides reticulotermitis JCM 10512 Isolate Rhinotermitidae
59 2695420314 Dysgonomonas sp. BGC7 Isolate Unclassified
60 2785510743 Apibacter sp. ESL0404 Isolate Apidae
61 2510917001 Candidatus Sulcia muelleri PSPU Isolate Aphrophoridae
62 2518645548 Blattabacterium sp. (Blaberus giganteus) Isolate Blaberidae
63 3002002726 Blattabacterium cuenoti PARATEMsp Isolate Blattellidae
64 3002027480 Blattabacterium cuenoti SCHULTlam Isolate Unclassified
65 3002031819 Blattabacterium cuenoti SHELFORDIsp Isolate Pseudophyllodromiidae
66 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
67 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
68 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
69 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
70 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
71 8065497608 Tellurirhabdus bombi IE-0392 Isolate Apidae
72 650716011 Blattabacterium sp. Bge Isolate Blattellidae
73 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
74 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
75 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
76 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
77 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
78 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
79 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
80 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
81 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
82 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
83 3002003370 Blattabacterium cuenoti THEREAreg Isolate Corydiidae
84 3002005207 Blattabacterium cuenoti MELANOZsp Isolate Blattidae
85 3002007112 Blattabacterium cuenoti CYRTOsp Isolate Blaberidae
86 3002008367 Blattabacterium cuenoti PARANAUcir Isolate Blaberidae
87 3002023256 Blattabacterium cuenoti RHABDOBsp Isolate Blaberidae
88 3002028747 Blattabacterium cuenoti ESCALves Isolate Blattellidae
89 3002030550 Blattabacterium cuenoti NEOLAXmac Isolate Blaberidae
90 3004677695 Bacteroides sp. 214 Isolate Blattidae
91 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
92 3300007068 Ant gut microbial communities from Cephalotes simillimus, Peru Metagenome Formicidae
93 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
94 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
95 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
96 644736337 Candidatus Sulcia muelleri SMDSEM Isolate Unclassified
97 8071415077 Blattabacterium cuenoti MACROPArhi Isolate Blaberidae
98 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
99 2864831662 Chryseobacterium sediminis S00068 Isolate Elmidae
100 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
101 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
102 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
103 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
104 2820211246 Unclassified Kiritimatiellaeota Nt197P3bin96 Isolate Unclassified
105 2820214248 Unclassified Kiritimatiellaeota Nt197P3bin16 Isolate Unclassified
106 2820750388 Unclassified Bacteroidetes Nt197P3bin50 Isolate Unclassified
107 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
108 3001995318 Blattabacterium cuenoti DYAKIkur Isolate Blattellidae
109 3002004631 Blattabacterium cuenoti ANAPome Isolate Anaplectidae
110 3002033046 Blattabacterium cuenoti ANALLAmet Isolate Blattellidae
111 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
112 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
113 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
114 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
115 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
116 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
117 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
118 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
119 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
120 638341057 Candidatus Sulcia muelleri Hc Isolate Cicadellidae
121 646311912 Blattabacterium sp. BPLAN Isolate Blattidae
122 8020009074 Elizabethkingia anophelis MSU001 Isolate Culicidae
123 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
124 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
125 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
126 2830041218 Bacteroides reticulotermitis DSM 105720 Isolate Unclassified
127 2832298047 Apibacter sp. wkB309 Isolate Apidae
128 2847090942 Elizabethkingia anophelis Ag1 Isolate Culicidae
129 2864882932 Chryseobacterium shingense S00136 Isolate Elmidae
130 2910930387 Dysgonomonas sp. 216 Isolate Blattidae
131 2910942425 Dysgonomonas sp. 521 Isolate Blattidae
132 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
133 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
134 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
135 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
136 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
137 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
138 2687453786 Chryseobacterium culicis DSM 23031 Isolate Unclassified
139 2599185120 Candidatus Sulcia muelleri BGSS Isolate Cicadellidae
140 3001995955 Blattabacterium cuenoti ANAPcal Isolate Anaplectidae
141 3002008998 Blattabacterium cuenoti PARCOBvir Isolate Blattellidae
142 3002022645 Blattabacterium cuenoti TRYONIpar Isolate Tryonicidae
143 3002025161 Blattabacterium cuenoti MEDIASdel Isolate Pseudophyllodromiidae
144 3002029927 Blattabacterium cuenoti CHORISOsp Isolate Pseudophyllodromiidae
145 3002031185 Blattabacterium cuenoti OPISTHori Isolate Blaberidae
146 3004672520 Bacteroides sp. 51 Isolate Blattidae
147 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
148 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
149 643348524 Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 Isolate Unclassified
150 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
151 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
152 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
153 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
154 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
155 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
156 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
157 2820762746 Unclassified Bacteroidetes Mp193P4bin3 Isolate Unclassified
158 2832372155 Apibacter adventoris wkB301 Isolate Apidae
159 2920168565 Paludibacter sp. 221 Isolate Blattidae
160 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
161 2940216256 Dysgonomonadaceae bacterium PH5-43 Isolate Blattidae
162 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
163 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
164 2820950349 Unclassified Acidobacteria Lab288P3bin89 Isolate Unclassified
165 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
166 2529292732 Elizabethkingia anophelis R26 Isolate Culicidae
167 2695420931 Dysgonomonas macrotermitis DSM 27370 Isolate Unclassified
168 2718218185 Candidatus Sulcia muelleri NC Isolate Cicadellidae
169 3002026852 Blattabacterium cuenoti BEYBkur Isolate Blattellidae
170 3300002464 Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 Metagenome Culicidae
171 3300007143 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut Metagenome Drosophilidae
172 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
173 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
174 2910926975 Dysgonomonas sp. 25 Isolate Blattidae
175 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
176 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
177 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
178 2799112231 Apibacter sp. ESL0432 Isolate Unclassified
179 2820209022 Unclassified Kiritimatiellaeota Th196P3bin76 Isolate Unclassified
180 2561511170 Blattabacterium sp. (Blatta orientalis) Tarazona Isolate Unclassified
181 3002005847 Blattabacterium cuenoti ECTOBIsp Isolate Ectobiidae
182 3002007740 Blattabacterium cuenoti NYCTIBsp Isolate Nyctiboridae
183 3002023891 Blattabacterium cuenoti MEGALOsp Isolate Nyctiboridae
184 3002028123 Blattabacterium cuenoti LAMPROsp Isolate Lamproblattidae
185 3004667792 Bacteroides sp. 519 Isolate Blattidae
186 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
187 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
188 3300021239 Termite gut microbial communities from nest from French Guiana - FG16_17_4 mRNA SA Metatranscriptome
189 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
190 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
191 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
192 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
193 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
194 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466697_274917 3300042611 Bacteria 203310
2 Ga0466705_168546 3300042612 Unclassified 2626
3 Ga0466705_245540 3300042612 Bacteria 8406
4 Ga0466705_520579 3300042612 Unclassified 14340
5 Ga0466711_512929 3300042615 Bacteria 34740
6 Ga0466723_168444 3300042618 Bacteria 8312
7 Ga0466723_219493 3300042618 Unclassified 25358
8 Ga0466723_225178 3300042618 Bacteria 15653
9 Ga0466726_034871 3300042619 Bacteria 2777
10 Ga0466728_228281 3300042620 Bacteria 35456
11 Ga0466703_068290 3300042636 Bacteria 26944
12 Ga0466703_394495 3300042636 Bacteria 16648
13 Ga0466704_042666 3300042643 Bacteria 6166
14 Ga0466704_081412 3300042643 Bacteria 8197
15 Ga0466709_254811 3300042648 Unclassified 7141
16 Ga0466709_419464 3300042648 Bacteria 2545
17 Ga0466708_068310 3300042652 Unclassified 8422
18 Ga0466708_096156 3300042652 Bacteria 6423
19 Ga0466708_139920 3300042652 Bacteria 25293
20 Ga0466708_186334 3300042652 Bacteria 3980
21 Ga0123356_10023384 3300010049 Bacteria 5817
22 Ga0123353_10305330 3300010167 Bacteria 2426
23 Ga0123354_10106268 3300010882 Bacteria 3748
24 Ga0466701_100973 3300042598 Bacteria 20020
25 Ga0466706_037446 3300042599 Bacteria 14530
26 Ga0466700_346138 3300042600 Bacteria 85747
27 Ga0466713_035234 3300042602 Bacteria 43574
28 Ga0466713_111742 3300042602 Bacteria 33326
29 Ga0466714_045032 3300042603 Bacteria 18346
30 Ga0466722_187750 3300042609 Bacteria 24322
31 Ga0160455_100004 3300012837 Bacteria 1044325
32 Ga0160433_100263 3300012846 Bacteria 36584
33 Ga0466690_134518 3300042590 Bacteria 19266
34 Ga0466690_179140 3300042590 Bacteria 10265
35 Ga0466692_008330 3300042591 Unclassified 1926
36 Ga0466691_054564 3300042593 Bacteria 7255
37 Ga0466696_034930 3300042596 Unclassified 6164
38 2227519922 2225789004 Bacteria 3362
39 IMNBL1DRAFT_c0000767 3300000062 Bacteria 25363
40 JGI24698J34947_10039004 3300002449 Unclassified 2461
41 JGI24698J34947_10047613 3300002449 Bacteria 2175
42 JGI24702J35022_10008902 3300002462 Bacteria 5661
43 Ga0068305_10119077 3300005083 Unclassified 7835
44 Ga0103265_1000010 3300007068 Bacteria 47599
45 Ga0466705_392266 3300042612 Bacteria 13021
46 Ga0466712_285137 3300042614 Bacteria 1663
47 Ga0466711_105713 3300042615 Bacteria 5958
48 Ga0466715_091816 3300042616 Bacteria 3100
49 Ga0466723_098355 3300042618 Bacteria 8928
50 Ga0466726_026362 3300042619 Bacteria 4595
51 Ga0466726_396100 3300042619 Bacteria 2685
52 Ga0466731_234519 3300042622 Bacteria 1312
53 Ga0466734_016397 3300042623 Bacteria 3109
54 Ga0466703_139687 3300042636 Bacteria 8183
55 Ga0466704_488735 3300042643 Bacteria 37994
56 Ga0466709_097181 3300042648 Bacteria 24423
57 Ga0466709_116163 3300042648 Bacteria 22126
58 Ga0466708_003364 3300042652 Bacteria 7003
59 Ga0466727_195414 3300042655 Bacteria 1876
60 Ga0123356_10004826 3300010049 Bacteria 13875
61 Ga0123353_10006334 3300010167 Bacteria 15741
62 Ga0123353_10047182 3300010167 Unclassified 6849
63 Ga0123353_10071451 3300010167 Bacteria 5576
64 Ga0123353_10369614 3300010167 Bacteria 2151
65 Ga0123354_10353919 3300010882 Unclassified 1305
66 Ga0466701_097135 3300042598 Bacteria 9341
67 Ga0466706_075913 3300042599 Bacteria 11122
68 Ga0466706_202707 3300042599 Bacteria 2921
69 Ga0466706_255509 3300042599 Bacteria 11125
70 Ga0466707_315479 3300042601 Bacteria 2667
71 Ga0466713_053928 3300042602 Bacteria 15271
72 Ga0466713_123354 3300042602 Bacteria 6638
73 Ga0466713_135974 3300042602 Bacteria 116031
74 Ga0466716_174365 3300042605 Bacteria 1798
75 Ga0466716_262179 3300042605 Bacteria 5988
76 Ga0466719_067713 3300042606 Bacteria 1975
77 Ga0466722_035543 3300042609 Bacteria 116913
78 Ga0466722_090744 3300042609 Bacteria 26452
79 Ga0160472_100013 3300012839 Bacteria 414792
80 Ga0223677_1000058 3300021239 Unclassified 1328
81 Ga0264413_116500 3300024493 Bacteria 1661
82 Ga0265387_1002506 3300024582 Bacteria 2579
83 Ga0265387_1006382 3300024582 Bacteria 1583
84 Ga0466690_141861 3300042590 Unclassified 8850
85 Ga0466690_296203 3300042590 Bacteria 11954
86 Ga0466693_052751 3300042592 Bacteria 1685
87 Ga0466693_362701 3300042592 Bacteria 1916
88 Ga0466691_123018 3300042593 Bacteria 2605
89 Ga0466696_014961 3300042596 Bacteria 77550
90 IMNBL1DRAFT_c0002938 3300000062 Bacteria 11372
91 JGI24702J35022_10007298 3300002462 Bacteria 6345
92 JGI24702J35022_10008831 3300002462 Bacteria 5689
93 JGI24702J35022_10027833 3300002462 Bacteria 3040
94 JGI24702J35022_10042612 3300002462 Bacteria 2417
95 JGI24702J35022_10087005 3300002462 Bacteria 1697
96 Meta3P_1002643 3300002464 Bacteria 29387
97 Ga0068305_10052790 3300005083 Bacteria 7837
98 Ga0072941_1098008 3300005201 Bacteria 6068
99 Ga0466705_080134 3300042612 Bacteria 8306
100 Ga0466705_122427 3300042612 Bacteria 8702
101 Ga0466732_148649 3300042656 Bacteria 2462
102 Ga0466733_014741 3300042659 Bacteria 52817
103 Ga0466733_058065 3300042659 Unclassified 2178
104 Ga0466733_133661 3300042659 Bacteria 10884
105 Ga0466733_147274 3300042659 Bacteria 6586
106 Ga0466705_467590 3300042612 Bacteria 7299
107 Ga0466710_190848 3300042613 Bacteria 2987
108 Ga0466710_295165 3300042613 Bacteria 4792
109 Ga0466711_266732 3300042615 Bacteria 11227
110 Ga0466711_311517 3300042615 Bacteria 3921
111 Ga0466711_489879 3300042615 Bacteria 17695
112 Ga0466715_240486 3300042616 Bacteria 5163
113 Ga0466715_334634 3300042616 Bacteria 13386
114 Ga0466715_349601 3300042616 Bacteria 20209
115 Ga0466715_389194 3300042616 Unclassified 3612
116 Ga0466723_227766 3300042618 Bacteria 2502
117 Ga0466728_065619 3300042620 Bacteria 98744
118 Ga0466734_044618 3300042623 Bacteria 2769
119 Ga0466703_339301 3300042636 Bacteria 24167
120 Ga0466704_093851 3300042643 Bacteria 15363
121 Ga0466704_576106 3300042643 Bacteria 4714
122 Ga0466709_139106 3300042648 Bacteria 11926
123 Ga0466709_281735 3300042648 Bacteria 6347
124 Ga0466724_22014 3300042649 Bacteria 158058
125 Ga0466727_015058 3300042655 Bacteria 77303
126 Ga0466727_259678 3300042655 Bacteria 9579
127 Ga0466727_279558 3300042655 Bacteria 7485
128 Ga0123357_10041625 3300009784 Bacteria 6247
129 Ga0123356_10211916 3300010049 Bacteria 1987
130 Ga0123353_10057978 3300010167 Bacteria 6204
131 Ga0123354_10080121 3300010882 Bacteria 4625
132 Ga0123354_10333377 3300010882 Bacteria 1379
133 Ga0466706_001547 3300042599 Bacteria 7040
134 Ga0466706_009507 3300042599 Bacteria 49149
135 Ga0466706_055045 3300042599 Bacteria 47604
136 Ga0466700_477570 3300042600 Bacteria 28301
137 Ga0466707_016058 3300042601 Bacteria 8130
138 Ga0466713_082448 3300042602 Bacteria 3366
139 Ga0466714_016461 3300042603 Bacteria 3871
140 Ga0466716_013754 3300042605 Unclassified 12829
141 Ga0466716_072706 3300042605 Bacteria 16792
142 Ga0466692_086972 3300042591 Bacteria 7711
143 Ga0466692_100322 3300042591 Bacteria 97018
144 Ga0466691_010581 3300042593 Bacteria 15300
145 Ga0466696_492819 3300042596 Bacteria 15827
146 2227464649 2225789004 Bacteria 5241
147 IMNBL1DRAFT_c0007118 3300000062 Bacteria 5950
148 JGI24705J35276_12238426 3300002504 Bacteria 21664
149 JGI24699J35502_11133088 3300002509 Bacteria 8633
150 JGI24699J35502_11134081 3300002509 Bacteria 28828
151 JGI24699J35502_11134223 3300002509 Bacteria 71514
152 Ga0103267_1000232 3300007190 Bacteria 26322
153 Ga0466705_022903 3300042612 Bacteria 8644
154 Ga0466705_094123 3300042612 Bacteria 9377
155 Ga0466705_189690 3300042612 Bacteria 49890
156 Ga0466705_344224 3300042612 Bacteria 18559
157 Ga0466711_080652 3300042615 Bacteria 4612
158 Ga0466711_221123 3300042615 Bacteria 5863
159 Ga0466711_348068 3300042615 Bacteria 1925
160 Ga0466715_488115 3300042616 Unclassified 2050
161 Ga0466723_122404 3300042618 Bacteria 8292
162 Ga0466726_089113 3300042619 Bacteria 1189
163 Ga0466726_421110 3300042619 Bacteria 15571
164 Ga0466728_070833 3300042620 Bacteria 41238
165 Ga0466735_020833 3300042624 Bacteria 3057
166 Ga0466703_280652 3300042636 Bacteria 3048
167 Ga0466704_368649 3300042643 Bacteria 31781
168 Ga0466708_036706 3300042652 Bacteria 2533
169 Ga0466708_047652 3300042652 Bacteria 25474
170 Ga0466708_058687 3300042652 Bacteria 40531
171 Ga0466708_086991 3300042652 Bacteria 84818
172 Ga0466727_087790 3300042655 Bacteria 7557
173 Ga0466727_294721 3300042655 Bacteria 20806
174 Ga0123357_10007479 3300009784 Bacteria 13506
175 Ga0123356_10008991 3300010049 Bacteria 9886
176 Ga0123356_10093229 3300010049 Bacteria 2873
177 Ga0123353_10000529 3300010167 Bacteria 47283
178 Ga0123353_10098135 3300010167 Bacteria 4722
179 Ga0123353_10136129 3300010167 Unclassified 3940
180 Ga0466706_121012 3300042599 Bacteria 39559
181 Ga0466706_145370 3300042599 Bacteria 23122
182 Ga0466706_172769 3300042599 Bacteria 12457
183 Ga0466706_180985 3300042599 Bacteria 37102
184 Ga0466706_268510 3300042599 Bacteria 14987
185 Ga0466707_028313 3300042601 Bacteria 5498
186 Ga0466713_010747 3300042602 Bacteria 5678
187 Ga0466713_037065 3300042602 Bacteria 12817
188 Ga0466713_139646 3300042602 Bacteria 516516
189 Ga0466716_019342 3300042605 Bacteria 10203
190 Ga0466716_455159 3300042605 Bacteria 7651
191 Ga0466719_045804 3300042606 Bacteria 7621
192 Ga0466722_143687 3300042609 Bacteria 15059
193 Ga0466722_173548 3300042609 Bacteria 31010
194 Ga0160468_100214 3300012819 Bacteria 36390
195 Ga0466690_102853 3300042590 Bacteria 5933
196 Ga0466690_195162 3300042590 Bacteria 23636
197 Ga0466690_198905 3300042590 Bacteria 12802
198 Ga0466690_240054 3300042590 Bacteria 6790
199 Ga0466690_254053 3300042590 Bacteria 10580
200 Ga0466692_078256 3300042591 Bacteria 4219
201 Ga0466693_145104 3300042592 Unclassified 1779
202 Ga0466696_215041 3300042596 Bacteria 9020
203 2227546029 2225789004 Bacteria 2919
204 IMNBL1DRAFT_c0000566 3300000062 Bacteria 29938
205 IMNBL1DRAFT_c0002309 3300000062 Bacteria 13385
206 Ga0068305_10002622 3300005083 Bacteria 23954
207 Ga0102736_1000057 3300007052 Bacteria 31963
208 Ga0466733_013318 3300042659 Bacteria 8517
209 Ga0466733_053675 3300042659 Bacteria 14016
210 Ga0466733_100739 3300042659 Bacteria 15317
211 Ga0466733_140132 3300042659 Bacteria 1153
212 Ga0562377_0004 3300056842 Bacteria 3525959
213 Ga0466705_446668 3300042612 Bacteria 5396
214 Ga0466705_479526 3300042612 Unclassified 5901
215 Ga0466710_013268 3300042613 Bacteria 3044
216 Ga0466710_230577 3300042613 Bacteria 1383
217 Ga0466711_104331 3300042615 Bacteria 2972
218 Ga0466711_507124 3300042615 Bacteria 4785
219 Ga0466715_050477 3300042616 Bacteria 53095
220 Ga0466715_076420 3300042616 Bacteria 5040
221 Ga0466715_113213 3300042616 Bacteria 91663
222 Ga0466715_342442 3300042616 Bacteria 12330
223 Ga0466723_130163 3300042618 Unclassified 3180
224 Ga0466723_186380 3300042618 Bacteria 10425
225 Ga0466723_350941 3300042618 Bacteria 5975
226 Ga0466726_235302 3300042619 Bacteria 19675
227 Ga0466726_410265 3300042619 Bacteria 18631
228 Ga0466729_137204 3300042621 Unclassified 1746
229 Ga0466729_256846 3300042621 Bacteria 2408
230 Ga0466729_259351 3300042621 Bacteria 6280
231 Ga0466729_265389 3300042621 Bacteria 3487
232 Ga0466734_170074 3300042623 Bacteria 5529
233 Ga0466735_122285 3300042624 Bacteria 3861
234 Ga0466735_231980 3300042624 Unclassified 5140
235 Ga0466730_065501 3300042625 Bacteria 3827
236 Ga0466703_025647 3300042636 Bacteria 8005
237 Ga0466703_108173 3300042636 Bacteria 2098
238 Ga0466703_300279 3300042636 Bacteria 8479
239 Ga0466704_039704 3300042643 Bacteria 4306
240 Ga0466704_358858 3300042643 Bacteria 16012
241 Ga0466708_186550 3300042652 Bacteria 6241
242 Ga0466727_049371 3300042655 Bacteria 6126
243 Ga0466727_085757 3300042655 Bacteria 6764
244 Ga0123357_10024482 3300009784 Bacteria 8128
245 Ga0123356_10009424 3300010049 Bacteria 9637
246 Ga0123354_10000424 3300010882 Bacteria 41153
247 Ga0466707_205846 3300042601 Bacteria 10000
248 Ga0466713_028590 3300042602 Bacteria 6326
249 Ga0466713_118645 3300042602 Bacteria 113373
250 Ga0466713_144891 3300042602 Bacteria 1492
251 Ga0466717_092714 3300042604 Bacteria 1365
252 Ga0466719_226595 3300042606 Bacteria 2152
253 Ga0466719_449486 3300042606 Bacteria 5602
254 Ga0466722_053616 3300042609 Bacteria 9252
255 Ga0466690_013411 3300042590 Bacteria 2390
256 Ga0466690_043136 3300042590 Bacteria 6015
257 Ga0466690_117931 3300042590 Bacteria 18892
258 Ga0466690_266218 3300042590 Bacteria 6639
259 Ga0466691_001560 3300042593 Bacteria 10792
260 Ga0466694_396619 3300042594 Bacteria 1321
261 Ga0466696_161097 3300042596 Bacteria 34931
262 Ga0466696_330437 3300042596 Bacteria 7398
263 Ga0466696_433488 3300042596 Bacteria 4812
264 2227063695 2225789003 Bacteria 16943
265 2227228884 2225789004 Bacteria 1369
266 IMNBL1DRAFT_c0002234 3300000062 Bacteria 13657
267 JGI24702J35022_10003198 3300002462 Bacteria 9914
268 JGI24702J35022_10084701 3300002462 Bacteria 1720
269 Ga0068305_10894693 3300005083 Bacteria 1820
270 Ga0072940_1093187 3300005200 Bacteria 3501
271 Ga0466705_088692 3300042612 Bacteria 10753
272 Ga0466705_386535 3300042612 Unclassified 2474
273 Ga0466715_123065 3300042616 Bacteria 16993
274 Ga0466715_487272 3300042616 Bacteria 4408
275 Ga0466715_488912 3300042616 Bacteria 1754
276 Ga0466723_336862 3300042618 Bacteria 51262
277 Ga0466726_056120 3300042619 Bacteria 2058
278 Ga0466726_144936 3300042619 Unclassified 4120
279 Ga0466728_011434 3300042620 Bacteria 17227
280 Ga0466728_082257 3300042620 Bacteria 106309
281 Ga0466734_047179 3300042623 Bacteria 1574
282 Ga0466730_011760 3300042625 Bacteria 327787
283 Ga0466703_305205 3300042636 Bacteria 11321
284 Ga0466704_075171 3300042643 Bacteria 9794
285 Ga0466704_077410 3300042643 Bacteria 8970
286 Ga0466704_115633 3300042643 Bacteria 47708
287 Ga0466704_152300 3300042643 Bacteria 11138
288 Ga0466704_292444 3300042643 Bacteria 6109
289 Ga0466709_122295 3300042648 Bacteria 64864
290 Ga0466709_340159 3300042648 Bacteria 7365
291 Ga0466724_29701 3300042649 Bacteria 2739
292 Ga0466708_069432 3300042652 Bacteria 45814
293 Ga0466708_307050 3300042652 Bacteria 51768
294 Ga0466725_033849 3300042654 Bacteria 8299
295 Ga0466725_259368 3300042654 Bacteria 32926
296 Ga0466727_058353 3300042655 Bacteria 6930
297 Ga0466727_171856 3300042655 Bacteria 16169
298 Ga0466727_348718 3300042655 Bacteria 2266
299 Ga0123357_10051923 3300009784 Bacteria 5539
300 Ga0123353_10000019 3300010167 Bacteria 185006
301 Ga0123353_10151451 3300010167 Unclassified 3703
302 Ga0123354_10275579 3300010882 Unclassified 1646
303 Ga0466706_037716 3300042599 Bacteria 4720
304 Ga0466706_051018 3300042599 Bacteria 5216
305 Ga0466706_053402 3300042599 Unclassified 1147
306 Ga0466706_118394 3300042599 Bacteria 4476
307 Ga0466706_205175 3300042599 Bacteria 25168
308 Ga0466700_294605 3300042600 Unclassified 4675
309 Ga0466707_065365 3300042601 Bacteria 18517
310 Ga0466707_318895 3300042601 Bacteria 29531
311 Ga0466707_409906 3300042601 Bacteria 2118
312 Ga0466713_056102 3300042602 Bacteria 4762
313 Ga0466713_061976 3300042602 Bacteria 17861
314 Ga0466716_405070 3300042605 Unclassified 2900
315 Ga0466719_453825 3300042606 Bacteria 1853
316 Ga0466721_022917 3300042608 Bacteria 9669
317 Ga0466722_206268 3300042609 Bacteria 7683
318 Ga0466690_101148 3300042590 Bacteria 6752
319 Ga0466690_294800 3300042590 Bacteria 12770
320 Ga0466691_122103 3300042593 Bacteria 4505
321 Ga0466694_361415 3300042594 Bacteria 6275
322 Ga0466695_329538 3300042595 Unclassified 1864
323 Ga0466696_044313 3300042596 Bacteria 1182
324 Ga0466696_365350 3300042596 Bacteria 1665
325 Ga0466699_315371 3300042597 Bacteria 1357
326 2227097483 2225789004 Bacteria 9673
327 IMNBL1DRAFT_c0000850 3300000062 Bacteria 23959
328 IMNBL1DRAFT_c0001620 3300000062 Bacteria 16684
329 IMNBL1DRAFT_c0005700 3300000062 Bacteria 7027
330 HBC_ctgsDRAFT_1000008 3300000333 Bacteria 58706
331 JGI24702J35022_10002224 3300002462 Bacteria 11933
332 JGI24702J35022_10018894 3300002462 Bacteria 3754
333 JGI24696J40584_12932366 3300002834 Bacteria 1501
334 Ga0102734_1000373 3300007129 Bacteria 42767
335 Ga0466705_079246 3300042612 Bacteria 6141
336 Ga0466733_040979 3300042659 Bacteria 3191
337 Ga0466733_045515 3300042659 Unclassified 2360
338 Ga0466733_119391 3300042659 Bacteria 5663
339 Ga0466733_159831 3300042659 Bacteria 3910
340 Ga0466705_528787 3300042612 Unclassified 3399
341 Ga0466710_420710 3300042613 Bacteria 2213
342 Ga0466712_172895 3300042614 Unclassified 1889
343 Ga0466711_053717 3300042615 Bacteria 8074
344 Ga0466715_086418 3300042616 Bacteria 17729
345 Ga0466715_471725 3300042616 Bacteria 9522
346 Ga0466723_300139 3300042618 Bacteria 23484
347 Ga0466723_305349 3300042618 Bacteria 16000
348 Ga0466723_314144 3300042618 Bacteria 7620
349 Ga0466726_068811 3300042619 Bacteria 4574
350 Ga0466726_123542 3300042619 Unclassified 3786
351 Ga0466726_133195 3300042619 Bacteria 1489
352 Ga0466728_423170 3300042620 Bacteria 23735
353 Ga0466729_095549 3300042621 Bacteria 14947
354 Ga0466735_028137 3300042624 Unclassified 4681
355 Ga0466735_087539 3300042624 Bacteria 6952
356 Ga0466735_138212 3300042624 Bacteria 1237
357 Ga0466735_192334 3300042624 Bacteria 3419
358 Ga0466703_060142 3300042636 Bacteria 7596
359 Ga0466703_112508 3300042636 Bacteria 13987
360 Ga0466703_263616 3300042636 Bacteria 5051
361 Ga0466704_419926 3300042643 Bacteria 34927
362 Ga0466704_498990 3300042643 Bacteria 20830
363 Ga0466709_159438 3300042648 Bacteria 10691
364 Ga0466727_028886 3300042655 Bacteria 9072
365 Ga0466727_210311 3300042655 Bacteria 3162
366 Ga0123354_10219556 3300010882 Bacteria 2025
367 Ga0466701_032343 3300042598 Bacteria 11792
368 Ga0466706_154666 3300042599 Bacteria 17657
369 Ga0466700_216462 3300042600 Bacteria 6334
370 Ga0466707_327412 3300042601 Bacteria 33932
371 Ga0466713_106122 3300042602 Bacteria 13962
372 Ga0466719_010043 3300042606 Unclassified 1841
373 Ga0466722_029780 3300042609 Bacteria 13820
374 Ga0466722_080397 3300042609 Bacteria 11708
375 Ga0466690_118775 3300042590 Bacteria 29964
376 Ga0466690_188044 3300042590 Bacteria 53126
377 Ga0466692_085757 3300042591 Bacteria 10543
378 Ga0466691_028936 3300042593 Bacteria 12625
379 Ga0466691_066150 3300042593 Bacteria 5895
380 Ga0466696_123114 3300042596 Bacteria 18671
381 Ga0466696_129222 3300042596 Bacteria 2200
382 Ga0466696_159127 3300042596 Bacteria 18902
383 Ga0466701_010990 3300042598 Bacteria 332169
384 IMNBGM34_c000084 3300000036 Bacteria 26546
385 JGI24705J35276_12206872 3300002504 Bacteria 1731
386 JGI24705J35276_12211687 3300002504 Unclassified 1864
387 Ga0068305_10193537 3300005083 Bacteria 6531
388 Ga0466697_188719 3300042611 Bacteria 1796
389 Ga0466705_266468 3300042612 Bacteria 9836
390 Ga0466733_076024 3300042659 Bacteria 2884
391 Ga0466733_081995 3300042659 Bacteria 115844
392 Ga0466733_216697 3300042659 Bacteria 189231
393 Ga0466711_152816 3300042615 Bacteria 26864
394 Ga0466711_184042 3300042615 Bacteria 19299
395 Ga0466715_039347 3300042616 Bacteria 8722
396 Ga0466715_265890 3300042616 Bacteria 3979
397 Ga0466715_394426 3300042616 Bacteria 7703
398 Ga0466723_306549 3300042618 Bacteria 5686
399 Ga0466728_093166 3300042620 Bacteria 80427
400 Ga0466728_104915 3300042620 Bacteria 11625
401 Ga0466728_399272 3300042620 Bacteria 209367
402 Ga0466728_407563 3300042620 Bacteria 9708
403 Ga0466729_099720 3300042621 Bacteria 12798
404 Ga0466734_156847 3300042623 Bacteria 8515
405 Ga0466735_000451 3300042624 Bacteria 15028
406 Ga0466735_136155 3300042624 Bacteria 5236
407 Ga0466735_149055 3300042624 Bacteria 3538
408 Ga0466703_127347 3300042636 Bacteria 8766
409 Ga0466703_162070 3300042636 Bacteria 8373
410 Ga0466703_198136 3300042636 Bacteria 8558
411 Ga0466703_323071 3300042636 Bacteria 8943
412 Ga0466704_075247 3300042643 Bacteria 7265
413 Ga0466704_092213 3300042643 Bacteria 1694
414 Ga0466727_103787 3300042655 Unclassified 3716
415 Ga0123357_10021662 3300009784 Bacteria 8604
416 Ga0123353_10095263 3300010167 Bacteria 4796
417 Ga0123353_10190447 3300010167 Bacteria 3238
418 Ga0123354_10005803 3300010882 Bacteria 18104
419 Ga0466706_024780 3300042599 Bacteria 27919
420 Ga0466706_163906 3300042599 Bacteria 105365
421 Ga0466700_156172 3300042600 Bacteria 109805
422 Ga0466700_324238 3300042600 Bacteria 8189
423 Ga0466707_044685 3300042601 Bacteria 4558
424 Ga0466707_075455 3300042601 Bacteria 9140
425 Ga0466707_410729 3300042601 Bacteria 18453
426 Ga0466713_083515 3300042602 Bacteria 1398
427 Ga0466713_092051 3300042602 Bacteria 141434
428 Ga0466713_101917 3300042602 Bacteria 17048
429 Ga0466713_129716 3300042602 Bacteria 104954
430 Ga0466714_074068 3300042603 Bacteria 3058
431 Ga0466714_112303 3300042603 Bacteria 6425
432 Ga0466714_149966 3300042603 Bacteria 61855
433 Ga0466717_171742 3300042604 Bacteria 3304
434 Ga0466716_294797 3300042605 Bacteria 42169
435 Ga0466716_366554 3300042605 Bacteria 7525
436 Ga0466716_489751 3300042605 Bacteria 5117
437 Ga0466719_149065 3300042606 Bacteria 2074
438 Ga0466719_183506 3300042606 Unclassified 1436
439 Ga0466719_294652 3300042606 Bacteria 3473
440 Ga0466719_524611 3300042606 Bacteria 5022
441 Ga0466722_065095 3300042609 Bacteria 3263
442 Ga0466722_145590 3300042609 Bacteria 4418
443 Ga0466657_039471 3300042582 Bacteria 1257
444 Ga0466690_005627 3300042590 Bacteria 17343
445 Ga0466690_105529 3300042590 Bacteria 20365
446 Ga0466692_008187 3300042591 Bacteria 121981
447 Ga0466692_110912 3300042591 Bacteria 24580
448 Ga0466691_038415 3300042593 Bacteria 13725
449 Ga0466691_149630 3300042593 Bacteria 3058
450 Ga0466691_170836 3300042593 Bacteria 7650
451 Ga0466696_029674 3300042596 Bacteria 8773
452 Ga0466696_074748 3300042596 Bacteria 8699
453 Ga0466696_105895 3300042596 Bacteria 3898
454 Ga0466696_429124 3300042596 Bacteria 2605
455 2227488552 2225789004 Bacteria 4164
456 2227535760 2225789004 Bacteria 15949
457 JGI24698J34947_10064785 3300002449 Bacteria 1784
458 JGI24699J35502_11133821 3300002509 Bacteria 16389
459 Ga0068302_10111956 3300005071 Bacteria 7815
460 Ga0104048_1025103 3300007143 Bacteria 3471
461 Ga0103264_1000101 3300007188 Bacteria 49856
462 Ga0127649_100531 3300009460 Bacteria 18197

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01450 IlvC Acetohydroxy acid isomeroreductase, catalytic domain 241 385 0.95
PF07991 IlvN Acetohydroxy acid isomeroreductase, NADPH-binding domain 67 233 0.93

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.