Protein Family IF03109
Metagenome
Metatranscriptome
Isolate
580
Members
194
Samples
462
Scaffolds
348.2
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_10071451|Ga0123353_100714513
- Length
- 406 aa
- Sequence
- MTKKAIFILHPVPEWLIKSFLLPVRCSASENHPYWRDTGMALIDFGGVNEQVVTRKEFPMTKARRALKNETIAVIGYGVQGPAQALNMKDNGFNVIVGQSKKYMKDWDRARKDGWIPGKTLFEIDEACKRGTVIEMLVSDAAQRTIWPEVKKHLTAGKTLYFSHGFSIAYKDLTKVVPPEDVDVVLVAPKGSGTSLRRNFLSGAGINSSFAVEQDATGKAREKCLALGIAVGSGYLFETTFQKEVFSDLTGERGILMGALAGVMEAQYDVLRKNGHSPSEAFNETVEELTESLIRLVAENGMDWMYSNCSATAQRGALDWKPKFKKAVEPVFKELYKKVADGTETKRVLSSCGKADYQEQLAKELKIIADSEMWQAGKTTRKLRPKEKAKTNAATAKGVKGRDAN*
Sample Types
Isolate
20.2%
Metagenome
79.7%
MAG
0.0%
Metatranscriptome
0.2%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
19.1%
Termitidae
16.0%
Unclassified
13.8%
Kalotermitidae
7.4%
Blaberidae
4.8%
Blattellidae
3.7%
Elmidae
3.2%
Rhinotermitidae
3.2%
Culicidae
3.2%
Apidae
3.2%
Formicidae
2.7%
Cicadellidae
2.7%
Pseudophyllodromiidae
2.1%
Passalidae
2.1%
Termopsidae
2.1%
Corydiidae
1.6%
Armadillidiidae
1.6%
Ectobiidae
1.1%
Hydrophilidae
1.1%
Anaplectidae
1.1%
Nyctiboridae
1.1%
Hodotermitidae
0.5%
Aphrophoridae
0.5%
Tenebrionidae
0.5%
Tryonicidae
0.5%
Drosophilidae
0.5%
Lamproblattidae
0.5%
Taxonomy
Archaea
0
Bacteria
540
Eukaryota
0
Viruses
0
Unclassified
40
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820768849 | Unclassified Bacteroidetes Lab288P3bin194 | Isolate | Unclassified |
| 2 | 2820774381 | Unclassified Bacteroidetes Lab288P1bin37 | Isolate | Unclassified |
| 3 | 2864923010 | Elizabethkingia anophelis S00177 | Isolate | Elmidae |
| 4 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 5 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 6 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 7 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 8 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 9 | 2820217359 | Unclassified Kiritimatiellaeota Nt197P3bin101 | Isolate | Unclassified |
| 10 | 3002002099 | Blattabacterium cuenoti ECTONUhan | Isolate | Ectobiidae |
| 11 | 3002004002 | Blattabacterium cuenoti EUPOLsin | Isolate | Corydiidae |
| 12 | 3002006476 | Blattabacterium cuenoti GYNAcap | Isolate | Blaberidae |
| 13 | 3002032411 | Blattabacterium cuenoti POLYPHAGsp | Isolate | Corydiidae |
| 14 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 15 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 16 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 17 | 3300009460 | Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov | Metagenome | |
| 18 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 19 | 641228484 | Candidatus Sulcia muelleri GWSS | Isolate | Cicadellidae |
| 20 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 21 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 22 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 23 | 8114076984 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 24 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 25 | 2832343623 | Apibacter adventoris wkB180 | Isolate | Apidae |
| 26 | 2864788197 | Elizabethkingia anophelis S00027 | Isolate | Elmidae |
| 27 | 2864822740 | Chryseobacterium shigense S00064 | Isolate | Elmidae |
| 28 | 2882250448 | Bizionia sp. APA-3 | Isolate | |
| 29 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 30 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 31 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 32 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 33 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 34 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 35 | 3002024525 | Blattabacterium cuenoti EPILAmay | Isolate | Blaberidae |
| 36 | 3002026254 | Blattabacterium cuenoti BALTAsp | Isolate | Pseudophyllodromiidae |
| 37 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 38 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 39 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 40 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 41 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 42 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 43 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 44 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 45 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 46 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 47 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 48 | 646564518 | Candidatus Sulcia muelleri DMIN (unscreened) | Isolate | Cicadellidae |
| 49 | 648028014 | Candidatus Sulcia muelleri CARI | Isolate | Unclassified |
| 50 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 51 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 52 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 53 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 54 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 55 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 56 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 57 | 2864948220 | Elizabethkingia anophelis S00205 | Isolate | Elmidae |
| 58 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 59 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 60 | 2785510743 | Apibacter sp. ESL0404 | Isolate | Apidae |
| 61 | 2510917001 | Candidatus Sulcia muelleri PSPU | Isolate | Aphrophoridae |
| 62 | 2518645548 | Blattabacterium sp. (Blaberus giganteus) | Isolate | Blaberidae |
| 63 | 3002002726 | Blattabacterium cuenoti PARATEMsp | Isolate | Blattellidae |
| 64 | 3002027480 | Blattabacterium cuenoti SCHULTlam | Isolate | Unclassified |
| 65 | 3002031819 | Blattabacterium cuenoti SHELFORDIsp | Isolate | Pseudophyllodromiidae |
| 66 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 67 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 68 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 69 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 70 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 71 | 8065497608 | Tellurirhabdus bombi IE-0392 | Isolate | Apidae |
| 72 | 650716011 | Blattabacterium sp. Bge | Isolate | Blattellidae |
| 73 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 74 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 75 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 76 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 77 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 78 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 79 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 80 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 81 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 82 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 83 | 3002003370 | Blattabacterium cuenoti THEREAreg | Isolate | Corydiidae |
| 84 | 3002005207 | Blattabacterium cuenoti MELANOZsp | Isolate | Blattidae |
| 85 | 3002007112 | Blattabacterium cuenoti CYRTOsp | Isolate | Blaberidae |
| 86 | 3002008367 | Blattabacterium cuenoti PARANAUcir | Isolate | Blaberidae |
| 87 | 3002023256 | Blattabacterium cuenoti RHABDOBsp | Isolate | Blaberidae |
| 88 | 3002028747 | Blattabacterium cuenoti ESCALves | Isolate | Blattellidae |
| 89 | 3002030550 | Blattabacterium cuenoti NEOLAXmac | Isolate | Blaberidae |
| 90 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 91 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 92 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 93 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 94 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 95 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 96 | 644736337 | Candidatus Sulcia muelleri SMDSEM | Isolate | Unclassified |
| 97 | 8071415077 | Blattabacterium cuenoti MACROPArhi | Isolate | Blaberidae |
| 98 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 99 | 2864831662 | Chryseobacterium sediminis S00068 | Isolate | Elmidae |
| 100 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 101 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 102 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 103 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 104 | 2820211246 | Unclassified Kiritimatiellaeota Nt197P3bin96 | Isolate | Unclassified |
| 105 | 2820214248 | Unclassified Kiritimatiellaeota Nt197P3bin16 | Isolate | Unclassified |
| 106 | 2820750388 | Unclassified Bacteroidetes Nt197P3bin50 | Isolate | Unclassified |
| 107 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 108 | 3001995318 | Blattabacterium cuenoti DYAKIkur | Isolate | Blattellidae |
| 109 | 3002004631 | Blattabacterium cuenoti ANAPome | Isolate | Anaplectidae |
| 110 | 3002033046 | Blattabacterium cuenoti ANALLAmet | Isolate | Blattellidae |
| 111 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 112 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 113 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 114 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 115 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 116 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 117 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 118 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 119 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 120 | 638341057 | Candidatus Sulcia muelleri Hc | Isolate | Cicadellidae |
| 121 | 646311912 | Blattabacterium sp. BPLAN | Isolate | Blattidae |
| 122 | 8020009074 | Elizabethkingia anophelis MSU001 | Isolate | Culicidae |
| 123 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 124 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 125 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 126 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 127 | 2832298047 | Apibacter sp. wkB309 | Isolate | Apidae |
| 128 | 2847090942 | Elizabethkingia anophelis Ag1 | Isolate | Culicidae |
| 129 | 2864882932 | Chryseobacterium shingense S00136 | Isolate | Elmidae |
| 130 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 131 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 132 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 133 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 134 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 135 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 136 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 137 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 138 | 2687453786 | Chryseobacterium culicis DSM 23031 | Isolate | Unclassified |
| 139 | 2599185120 | Candidatus Sulcia muelleri BGSS | Isolate | Cicadellidae |
| 140 | 3001995955 | Blattabacterium cuenoti ANAPcal | Isolate | Anaplectidae |
| 141 | 3002008998 | Blattabacterium cuenoti PARCOBvir | Isolate | Blattellidae |
| 142 | 3002022645 | Blattabacterium cuenoti TRYONIpar | Isolate | Tryonicidae |
| 143 | 3002025161 | Blattabacterium cuenoti MEDIASdel | Isolate | Pseudophyllodromiidae |
| 144 | 3002029927 | Blattabacterium cuenoti CHORISOsp | Isolate | Pseudophyllodromiidae |
| 145 | 3002031185 | Blattabacterium cuenoti OPISTHori | Isolate | Blaberidae |
| 146 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 147 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 148 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 149 | 643348524 | Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 | Isolate | Unclassified |
| 150 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 151 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 152 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 153 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 154 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 155 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 156 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 157 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 158 | 2832372155 | Apibacter adventoris wkB301 | Isolate | Apidae |
| 159 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 160 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 161 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 162 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 163 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 164 | 2820950349 | Unclassified Acidobacteria Lab288P3bin89 | Isolate | Unclassified |
| 165 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 166 | 2529292732 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 167 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 168 | 2718218185 | Candidatus Sulcia muelleri NC | Isolate | Cicadellidae |
| 169 | 3002026852 | Blattabacterium cuenoti BEYBkur | Isolate | Blattellidae |
| 170 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 171 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 172 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 173 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 174 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 175 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 176 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 177 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 178 | 2799112231 | Apibacter sp. ESL0432 | Isolate | Unclassified |
| 179 | 2820209022 | Unclassified Kiritimatiellaeota Th196P3bin76 | Isolate | Unclassified |
| 180 | 2561511170 | Blattabacterium sp. (Blatta orientalis) Tarazona | Isolate | Unclassified |
| 181 | 3002005847 | Blattabacterium cuenoti ECTOBIsp | Isolate | Ectobiidae |
| 182 | 3002007740 | Blattabacterium cuenoti NYCTIBsp | Isolate | Nyctiboridae |
| 183 | 3002023891 | Blattabacterium cuenoti MEGALOsp | Isolate | Nyctiboridae |
| 184 | 3002028123 | Blattabacterium cuenoti LAMPROsp | Isolate | Lamproblattidae |
| 185 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 186 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 187 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 188 | 3300021239 | Termite gut microbial communities from nest from French Guiana - FG16_17_4 mRNA SA | Metatranscriptome | |
| 189 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 190 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 191 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 192 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 193 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 194 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_274917 | 3300042611 | Bacteria | 203310 |
| 2 | Ga0466705_168546 | 3300042612 | Unclassified | 2626 |
| 3 | Ga0466705_245540 | 3300042612 | Bacteria | 8406 |
| 4 | Ga0466705_520579 | 3300042612 | Unclassified | 14340 |
| 5 | Ga0466711_512929 | 3300042615 | Bacteria | 34740 |
| 6 | Ga0466723_168444 | 3300042618 | Bacteria | 8312 |
| 7 | Ga0466723_219493 | 3300042618 | Unclassified | 25358 |
| 8 | Ga0466723_225178 | 3300042618 | Bacteria | 15653 |
| 9 | Ga0466726_034871 | 3300042619 | Bacteria | 2777 |
| 10 | Ga0466728_228281 | 3300042620 | Bacteria | 35456 |
| 11 | Ga0466703_068290 | 3300042636 | Bacteria | 26944 |
| 12 | Ga0466703_394495 | 3300042636 | Bacteria | 16648 |
| 13 | Ga0466704_042666 | 3300042643 | Bacteria | 6166 |
| 14 | Ga0466704_081412 | 3300042643 | Bacteria | 8197 |
| 15 | Ga0466709_254811 | 3300042648 | Unclassified | 7141 |
| 16 | Ga0466709_419464 | 3300042648 | Bacteria | 2545 |
| 17 | Ga0466708_068310 | 3300042652 | Unclassified | 8422 |
| 18 | Ga0466708_096156 | 3300042652 | Bacteria | 6423 |
| 19 | Ga0466708_139920 | 3300042652 | Bacteria | 25293 |
| 20 | Ga0466708_186334 | 3300042652 | Bacteria | 3980 |
| 21 | Ga0123356_10023384 | 3300010049 | Bacteria | 5817 |
| 22 | Ga0123353_10305330 | 3300010167 | Bacteria | 2426 |
| 23 | Ga0123354_10106268 | 3300010882 | Bacteria | 3748 |
| 24 | Ga0466701_100973 | 3300042598 | Bacteria | 20020 |
| 25 | Ga0466706_037446 | 3300042599 | Bacteria | 14530 |
| 26 | Ga0466700_346138 | 3300042600 | Bacteria | 85747 |
| 27 | Ga0466713_035234 | 3300042602 | Bacteria | 43574 |
| 28 | Ga0466713_111742 | 3300042602 | Bacteria | 33326 |
| 29 | Ga0466714_045032 | 3300042603 | Bacteria | 18346 |
| 30 | Ga0466722_187750 | 3300042609 | Bacteria | 24322 |
| 31 | Ga0160455_100004 | 3300012837 | Bacteria | 1044325 |
| 32 | Ga0160433_100263 | 3300012846 | Bacteria | 36584 |
| 33 | Ga0466690_134518 | 3300042590 | Bacteria | 19266 |
| 34 | Ga0466690_179140 | 3300042590 | Bacteria | 10265 |
| 35 | Ga0466692_008330 | 3300042591 | Unclassified | 1926 |
| 36 | Ga0466691_054564 | 3300042593 | Bacteria | 7255 |
| 37 | Ga0466696_034930 | 3300042596 | Unclassified | 6164 |
| 38 | 2227519922 | 2225789004 | Bacteria | 3362 |
| 39 | IMNBL1DRAFT_c0000767 | 3300000062 | Bacteria | 25363 |
| 40 | JGI24698J34947_10039004 | 3300002449 | Unclassified | 2461 |
| 41 | JGI24698J34947_10047613 | 3300002449 | Bacteria | 2175 |
| 42 | JGI24702J35022_10008902 | 3300002462 | Bacteria | 5661 |
| 43 | Ga0068305_10119077 | 3300005083 | Unclassified | 7835 |
| 44 | Ga0103265_1000010 | 3300007068 | Bacteria | 47599 |
| 45 | Ga0466705_392266 | 3300042612 | Bacteria | 13021 |
| 46 | Ga0466712_285137 | 3300042614 | Bacteria | 1663 |
| 47 | Ga0466711_105713 | 3300042615 | Bacteria | 5958 |
| 48 | Ga0466715_091816 | 3300042616 | Bacteria | 3100 |
| 49 | Ga0466723_098355 | 3300042618 | Bacteria | 8928 |
| 50 | Ga0466726_026362 | 3300042619 | Bacteria | 4595 |
| 51 | Ga0466726_396100 | 3300042619 | Bacteria | 2685 |
| 52 | Ga0466731_234519 | 3300042622 | Bacteria | 1312 |
| 53 | Ga0466734_016397 | 3300042623 | Bacteria | 3109 |
| 54 | Ga0466703_139687 | 3300042636 | Bacteria | 8183 |
| 55 | Ga0466704_488735 | 3300042643 | Bacteria | 37994 |
| 56 | Ga0466709_097181 | 3300042648 | Bacteria | 24423 |
| 57 | Ga0466709_116163 | 3300042648 | Bacteria | 22126 |
| 58 | Ga0466708_003364 | 3300042652 | Bacteria | 7003 |
| 59 | Ga0466727_195414 | 3300042655 | Bacteria | 1876 |
| 60 | Ga0123356_10004826 | 3300010049 | Bacteria | 13875 |
| 61 | Ga0123353_10006334 | 3300010167 | Bacteria | 15741 |
| 62 | Ga0123353_10047182 | 3300010167 | Unclassified | 6849 |
| 63 | Ga0123353_10071451 | 3300010167 | Bacteria | 5576 |
| 64 | Ga0123353_10369614 | 3300010167 | Bacteria | 2151 |
| 65 | Ga0123354_10353919 | 3300010882 | Unclassified | 1305 |
| 66 | Ga0466701_097135 | 3300042598 | Bacteria | 9341 |
| 67 | Ga0466706_075913 | 3300042599 | Bacteria | 11122 |
| 68 | Ga0466706_202707 | 3300042599 | Bacteria | 2921 |
| 69 | Ga0466706_255509 | 3300042599 | Bacteria | 11125 |
| 70 | Ga0466707_315479 | 3300042601 | Bacteria | 2667 |
| 71 | Ga0466713_053928 | 3300042602 | Bacteria | 15271 |
| 72 | Ga0466713_123354 | 3300042602 | Bacteria | 6638 |
| 73 | Ga0466713_135974 | 3300042602 | Bacteria | 116031 |
| 74 | Ga0466716_174365 | 3300042605 | Bacteria | 1798 |
| 75 | Ga0466716_262179 | 3300042605 | Bacteria | 5988 |
| 76 | Ga0466719_067713 | 3300042606 | Bacteria | 1975 |
| 77 | Ga0466722_035543 | 3300042609 | Bacteria | 116913 |
| 78 | Ga0466722_090744 | 3300042609 | Bacteria | 26452 |
| 79 | Ga0160472_100013 | 3300012839 | Bacteria | 414792 |
| 80 | Ga0223677_1000058 | 3300021239 | Unclassified | 1328 |
| 81 | Ga0264413_116500 | 3300024493 | Bacteria | 1661 |
| 82 | Ga0265387_1002506 | 3300024582 | Bacteria | 2579 |
| 83 | Ga0265387_1006382 | 3300024582 | Bacteria | 1583 |
| 84 | Ga0466690_141861 | 3300042590 | Unclassified | 8850 |
| 85 | Ga0466690_296203 | 3300042590 | Bacteria | 11954 |
| 86 | Ga0466693_052751 | 3300042592 | Bacteria | 1685 |
| 87 | Ga0466693_362701 | 3300042592 | Bacteria | 1916 |
| 88 | Ga0466691_123018 | 3300042593 | Bacteria | 2605 |
| 89 | Ga0466696_014961 | 3300042596 | Bacteria | 77550 |
| 90 | IMNBL1DRAFT_c0002938 | 3300000062 | Bacteria | 11372 |
| 91 | JGI24702J35022_10007298 | 3300002462 | Bacteria | 6345 |
| 92 | JGI24702J35022_10008831 | 3300002462 | Bacteria | 5689 |
| 93 | JGI24702J35022_10027833 | 3300002462 | Bacteria | 3040 |
| 94 | JGI24702J35022_10042612 | 3300002462 | Bacteria | 2417 |
| 95 | JGI24702J35022_10087005 | 3300002462 | Bacteria | 1697 |
| 96 | Meta3P_1002643 | 3300002464 | Bacteria | 29387 |
| 97 | Ga0068305_10052790 | 3300005083 | Bacteria | 7837 |
| 98 | Ga0072941_1098008 | 3300005201 | Bacteria | 6068 |
| 99 | Ga0466705_080134 | 3300042612 | Bacteria | 8306 |
| 100 | Ga0466705_122427 | 3300042612 | Bacteria | 8702 |
| 101 | Ga0466732_148649 | 3300042656 | Bacteria | 2462 |
| 102 | Ga0466733_014741 | 3300042659 | Bacteria | 52817 |
| 103 | Ga0466733_058065 | 3300042659 | Unclassified | 2178 |
| 104 | Ga0466733_133661 | 3300042659 | Bacteria | 10884 |
| 105 | Ga0466733_147274 | 3300042659 | Bacteria | 6586 |
| 106 | Ga0466705_467590 | 3300042612 | Bacteria | 7299 |
| 107 | Ga0466710_190848 | 3300042613 | Bacteria | 2987 |
| 108 | Ga0466710_295165 | 3300042613 | Bacteria | 4792 |
| 109 | Ga0466711_266732 | 3300042615 | Bacteria | 11227 |
| 110 | Ga0466711_311517 | 3300042615 | Bacteria | 3921 |
| 111 | Ga0466711_489879 | 3300042615 | Bacteria | 17695 |
| 112 | Ga0466715_240486 | 3300042616 | Bacteria | 5163 |
| 113 | Ga0466715_334634 | 3300042616 | Bacteria | 13386 |
| 114 | Ga0466715_349601 | 3300042616 | Bacteria | 20209 |
| 115 | Ga0466715_389194 | 3300042616 | Unclassified | 3612 |
| 116 | Ga0466723_227766 | 3300042618 | Bacteria | 2502 |
| 117 | Ga0466728_065619 | 3300042620 | Bacteria | 98744 |
| 118 | Ga0466734_044618 | 3300042623 | Bacteria | 2769 |
| 119 | Ga0466703_339301 | 3300042636 | Bacteria | 24167 |
| 120 | Ga0466704_093851 | 3300042643 | Bacteria | 15363 |
| 121 | Ga0466704_576106 | 3300042643 | Bacteria | 4714 |
| 122 | Ga0466709_139106 | 3300042648 | Bacteria | 11926 |
| 123 | Ga0466709_281735 | 3300042648 | Bacteria | 6347 |
| 124 | Ga0466724_22014 | 3300042649 | Bacteria | 158058 |
| 125 | Ga0466727_015058 | 3300042655 | Bacteria | 77303 |
| 126 | Ga0466727_259678 | 3300042655 | Bacteria | 9579 |
| 127 | Ga0466727_279558 | 3300042655 | Bacteria | 7485 |
| 128 | Ga0123357_10041625 | 3300009784 | Bacteria | 6247 |
| 129 | Ga0123356_10211916 | 3300010049 | Bacteria | 1987 |
| 130 | Ga0123353_10057978 | 3300010167 | Bacteria | 6204 |
| 131 | Ga0123354_10080121 | 3300010882 | Bacteria | 4625 |
| 132 | Ga0123354_10333377 | 3300010882 | Bacteria | 1379 |
| 133 | Ga0466706_001547 | 3300042599 | Bacteria | 7040 |
| 134 | Ga0466706_009507 | 3300042599 | Bacteria | 49149 |
| 135 | Ga0466706_055045 | 3300042599 | Bacteria | 47604 |
| 136 | Ga0466700_477570 | 3300042600 | Bacteria | 28301 |
| 137 | Ga0466707_016058 | 3300042601 | Bacteria | 8130 |
| 138 | Ga0466713_082448 | 3300042602 | Bacteria | 3366 |
| 139 | Ga0466714_016461 | 3300042603 | Bacteria | 3871 |
| 140 | Ga0466716_013754 | 3300042605 | Unclassified | 12829 |
| 141 | Ga0466716_072706 | 3300042605 | Bacteria | 16792 |
| 142 | Ga0466692_086972 | 3300042591 | Bacteria | 7711 |
| 143 | Ga0466692_100322 | 3300042591 | Bacteria | 97018 |
| 144 | Ga0466691_010581 | 3300042593 | Bacteria | 15300 |
| 145 | Ga0466696_492819 | 3300042596 | Bacteria | 15827 |
| 146 | 2227464649 | 2225789004 | Bacteria | 5241 |
| 147 | IMNBL1DRAFT_c0007118 | 3300000062 | Bacteria | 5950 |
| 148 | JGI24705J35276_12238426 | 3300002504 | Bacteria | 21664 |
| 149 | JGI24699J35502_11133088 | 3300002509 | Bacteria | 8633 |
| 150 | JGI24699J35502_11134081 | 3300002509 | Bacteria | 28828 |
| 151 | JGI24699J35502_11134223 | 3300002509 | Bacteria | 71514 |
| 152 | Ga0103267_1000232 | 3300007190 | Bacteria | 26322 |
| 153 | Ga0466705_022903 | 3300042612 | Bacteria | 8644 |
| 154 | Ga0466705_094123 | 3300042612 | Bacteria | 9377 |
| 155 | Ga0466705_189690 | 3300042612 | Bacteria | 49890 |
| 156 | Ga0466705_344224 | 3300042612 | Bacteria | 18559 |
| 157 | Ga0466711_080652 | 3300042615 | Bacteria | 4612 |
| 158 | Ga0466711_221123 | 3300042615 | Bacteria | 5863 |
| 159 | Ga0466711_348068 | 3300042615 | Bacteria | 1925 |
| 160 | Ga0466715_488115 | 3300042616 | Unclassified | 2050 |
| 161 | Ga0466723_122404 | 3300042618 | Bacteria | 8292 |
| 162 | Ga0466726_089113 | 3300042619 | Bacteria | 1189 |
| 163 | Ga0466726_421110 | 3300042619 | Bacteria | 15571 |
| 164 | Ga0466728_070833 | 3300042620 | Bacteria | 41238 |
| 165 | Ga0466735_020833 | 3300042624 | Bacteria | 3057 |
| 166 | Ga0466703_280652 | 3300042636 | Bacteria | 3048 |
| 167 | Ga0466704_368649 | 3300042643 | Bacteria | 31781 |
| 168 | Ga0466708_036706 | 3300042652 | Bacteria | 2533 |
| 169 | Ga0466708_047652 | 3300042652 | Bacteria | 25474 |
| 170 | Ga0466708_058687 | 3300042652 | Bacteria | 40531 |
| 171 | Ga0466708_086991 | 3300042652 | Bacteria | 84818 |
| 172 | Ga0466727_087790 | 3300042655 | Bacteria | 7557 |
| 173 | Ga0466727_294721 | 3300042655 | Bacteria | 20806 |
| 174 | Ga0123357_10007479 | 3300009784 | Bacteria | 13506 |
| 175 | Ga0123356_10008991 | 3300010049 | Bacteria | 9886 |
| 176 | Ga0123356_10093229 | 3300010049 | Bacteria | 2873 |
| 177 | Ga0123353_10000529 | 3300010167 | Bacteria | 47283 |
| 178 | Ga0123353_10098135 | 3300010167 | Bacteria | 4722 |
| 179 | Ga0123353_10136129 | 3300010167 | Unclassified | 3940 |
| 180 | Ga0466706_121012 | 3300042599 | Bacteria | 39559 |
| 181 | Ga0466706_145370 | 3300042599 | Bacteria | 23122 |
| 182 | Ga0466706_172769 | 3300042599 | Bacteria | 12457 |
| 183 | Ga0466706_180985 | 3300042599 | Bacteria | 37102 |
| 184 | Ga0466706_268510 | 3300042599 | Bacteria | 14987 |
| 185 | Ga0466707_028313 | 3300042601 | Bacteria | 5498 |
| 186 | Ga0466713_010747 | 3300042602 | Bacteria | 5678 |
| 187 | Ga0466713_037065 | 3300042602 | Bacteria | 12817 |
| 188 | Ga0466713_139646 | 3300042602 | Bacteria | 516516 |
| 189 | Ga0466716_019342 | 3300042605 | Bacteria | 10203 |
| 190 | Ga0466716_455159 | 3300042605 | Bacteria | 7651 |
| 191 | Ga0466719_045804 | 3300042606 | Bacteria | 7621 |
| 192 | Ga0466722_143687 | 3300042609 | Bacteria | 15059 |
| 193 | Ga0466722_173548 | 3300042609 | Bacteria | 31010 |
| 194 | Ga0160468_100214 | 3300012819 | Bacteria | 36390 |
| 195 | Ga0466690_102853 | 3300042590 | Bacteria | 5933 |
| 196 | Ga0466690_195162 | 3300042590 | Bacteria | 23636 |
| 197 | Ga0466690_198905 | 3300042590 | Bacteria | 12802 |
| 198 | Ga0466690_240054 | 3300042590 | Bacteria | 6790 |
| 199 | Ga0466690_254053 | 3300042590 | Bacteria | 10580 |
| 200 | Ga0466692_078256 | 3300042591 | Bacteria | 4219 |
| 201 | Ga0466693_145104 | 3300042592 | Unclassified | 1779 |
| 202 | Ga0466696_215041 | 3300042596 | Bacteria | 9020 |
| 203 | 2227546029 | 2225789004 | Bacteria | 2919 |
| 204 | IMNBL1DRAFT_c0000566 | 3300000062 | Bacteria | 29938 |
| 205 | IMNBL1DRAFT_c0002309 | 3300000062 | Bacteria | 13385 |
| 206 | Ga0068305_10002622 | 3300005083 | Bacteria | 23954 |
| 207 | Ga0102736_1000057 | 3300007052 | Bacteria | 31963 |
| 208 | Ga0466733_013318 | 3300042659 | Bacteria | 8517 |
| 209 | Ga0466733_053675 | 3300042659 | Bacteria | 14016 |
| 210 | Ga0466733_100739 | 3300042659 | Bacteria | 15317 |
| 211 | Ga0466733_140132 | 3300042659 | Bacteria | 1153 |
| 212 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 213 | Ga0466705_446668 | 3300042612 | Bacteria | 5396 |
| 214 | Ga0466705_479526 | 3300042612 | Unclassified | 5901 |
| 215 | Ga0466710_013268 | 3300042613 | Bacteria | 3044 |
| 216 | Ga0466710_230577 | 3300042613 | Bacteria | 1383 |
| 217 | Ga0466711_104331 | 3300042615 | Bacteria | 2972 |
| 218 | Ga0466711_507124 | 3300042615 | Bacteria | 4785 |
| 219 | Ga0466715_050477 | 3300042616 | Bacteria | 53095 |
| 220 | Ga0466715_076420 | 3300042616 | Bacteria | 5040 |
| 221 | Ga0466715_113213 | 3300042616 | Bacteria | 91663 |
| 222 | Ga0466715_342442 | 3300042616 | Bacteria | 12330 |
| 223 | Ga0466723_130163 | 3300042618 | Unclassified | 3180 |
| 224 | Ga0466723_186380 | 3300042618 | Bacteria | 10425 |
| 225 | Ga0466723_350941 | 3300042618 | Bacteria | 5975 |
| 226 | Ga0466726_235302 | 3300042619 | Bacteria | 19675 |
| 227 | Ga0466726_410265 | 3300042619 | Bacteria | 18631 |
| 228 | Ga0466729_137204 | 3300042621 | Unclassified | 1746 |
| 229 | Ga0466729_256846 | 3300042621 | Bacteria | 2408 |
| 230 | Ga0466729_259351 | 3300042621 | Bacteria | 6280 |
| 231 | Ga0466729_265389 | 3300042621 | Bacteria | 3487 |
| 232 | Ga0466734_170074 | 3300042623 | Bacteria | 5529 |
| 233 | Ga0466735_122285 | 3300042624 | Bacteria | 3861 |
| 234 | Ga0466735_231980 | 3300042624 | Unclassified | 5140 |
| 235 | Ga0466730_065501 | 3300042625 | Bacteria | 3827 |
| 236 | Ga0466703_025647 | 3300042636 | Bacteria | 8005 |
| 237 | Ga0466703_108173 | 3300042636 | Bacteria | 2098 |
| 238 | Ga0466703_300279 | 3300042636 | Bacteria | 8479 |
| 239 | Ga0466704_039704 | 3300042643 | Bacteria | 4306 |
| 240 | Ga0466704_358858 | 3300042643 | Bacteria | 16012 |
| 241 | Ga0466708_186550 | 3300042652 | Bacteria | 6241 |
| 242 | Ga0466727_049371 | 3300042655 | Bacteria | 6126 |
| 243 | Ga0466727_085757 | 3300042655 | Bacteria | 6764 |
| 244 | Ga0123357_10024482 | 3300009784 | Bacteria | 8128 |
| 245 | Ga0123356_10009424 | 3300010049 | Bacteria | 9637 |
| 246 | Ga0123354_10000424 | 3300010882 | Bacteria | 41153 |
| 247 | Ga0466707_205846 | 3300042601 | Bacteria | 10000 |
| 248 | Ga0466713_028590 | 3300042602 | Bacteria | 6326 |
| 249 | Ga0466713_118645 | 3300042602 | Bacteria | 113373 |
| 250 | Ga0466713_144891 | 3300042602 | Bacteria | 1492 |
| 251 | Ga0466717_092714 | 3300042604 | Bacteria | 1365 |
| 252 | Ga0466719_226595 | 3300042606 | Bacteria | 2152 |
| 253 | Ga0466719_449486 | 3300042606 | Bacteria | 5602 |
| 254 | Ga0466722_053616 | 3300042609 | Bacteria | 9252 |
| 255 | Ga0466690_013411 | 3300042590 | Bacteria | 2390 |
| 256 | Ga0466690_043136 | 3300042590 | Bacteria | 6015 |
| 257 | Ga0466690_117931 | 3300042590 | Bacteria | 18892 |
| 258 | Ga0466690_266218 | 3300042590 | Bacteria | 6639 |
| 259 | Ga0466691_001560 | 3300042593 | Bacteria | 10792 |
| 260 | Ga0466694_396619 | 3300042594 | Bacteria | 1321 |
| 261 | Ga0466696_161097 | 3300042596 | Bacteria | 34931 |
| 262 | Ga0466696_330437 | 3300042596 | Bacteria | 7398 |
| 263 | Ga0466696_433488 | 3300042596 | Bacteria | 4812 |
| 264 | 2227063695 | 2225789003 | Bacteria | 16943 |
| 265 | 2227228884 | 2225789004 | Bacteria | 1369 |
| 266 | IMNBL1DRAFT_c0002234 | 3300000062 | Bacteria | 13657 |
| 267 | JGI24702J35022_10003198 | 3300002462 | Bacteria | 9914 |
| 268 | JGI24702J35022_10084701 | 3300002462 | Bacteria | 1720 |
| 269 | Ga0068305_10894693 | 3300005083 | Bacteria | 1820 |
| 270 | Ga0072940_1093187 | 3300005200 | Bacteria | 3501 |
| 271 | Ga0466705_088692 | 3300042612 | Bacteria | 10753 |
| 272 | Ga0466705_386535 | 3300042612 | Unclassified | 2474 |
| 273 | Ga0466715_123065 | 3300042616 | Bacteria | 16993 |
| 274 | Ga0466715_487272 | 3300042616 | Bacteria | 4408 |
| 275 | Ga0466715_488912 | 3300042616 | Bacteria | 1754 |
| 276 | Ga0466723_336862 | 3300042618 | Bacteria | 51262 |
| 277 | Ga0466726_056120 | 3300042619 | Bacteria | 2058 |
| 278 | Ga0466726_144936 | 3300042619 | Unclassified | 4120 |
| 279 | Ga0466728_011434 | 3300042620 | Bacteria | 17227 |
| 280 | Ga0466728_082257 | 3300042620 | Bacteria | 106309 |
| 281 | Ga0466734_047179 | 3300042623 | Bacteria | 1574 |
| 282 | Ga0466730_011760 | 3300042625 | Bacteria | 327787 |
| 283 | Ga0466703_305205 | 3300042636 | Bacteria | 11321 |
| 284 | Ga0466704_075171 | 3300042643 | Bacteria | 9794 |
| 285 | Ga0466704_077410 | 3300042643 | Bacteria | 8970 |
| 286 | Ga0466704_115633 | 3300042643 | Bacteria | 47708 |
| 287 | Ga0466704_152300 | 3300042643 | Bacteria | 11138 |
| 288 | Ga0466704_292444 | 3300042643 | Bacteria | 6109 |
| 289 | Ga0466709_122295 | 3300042648 | Bacteria | 64864 |
| 290 | Ga0466709_340159 | 3300042648 | Bacteria | 7365 |
| 291 | Ga0466724_29701 | 3300042649 | Bacteria | 2739 |
| 292 | Ga0466708_069432 | 3300042652 | Bacteria | 45814 |
| 293 | Ga0466708_307050 | 3300042652 | Bacteria | 51768 |
| 294 | Ga0466725_033849 | 3300042654 | Bacteria | 8299 |
| 295 | Ga0466725_259368 | 3300042654 | Bacteria | 32926 |
| 296 | Ga0466727_058353 | 3300042655 | Bacteria | 6930 |
| 297 | Ga0466727_171856 | 3300042655 | Bacteria | 16169 |
| 298 | Ga0466727_348718 | 3300042655 | Bacteria | 2266 |
| 299 | Ga0123357_10051923 | 3300009784 | Bacteria | 5539 |
| 300 | Ga0123353_10000019 | 3300010167 | Bacteria | 185006 |
| 301 | Ga0123353_10151451 | 3300010167 | Unclassified | 3703 |
| 302 | Ga0123354_10275579 | 3300010882 | Unclassified | 1646 |
| 303 | Ga0466706_037716 | 3300042599 | Bacteria | 4720 |
| 304 | Ga0466706_051018 | 3300042599 | Bacteria | 5216 |
| 305 | Ga0466706_053402 | 3300042599 | Unclassified | 1147 |
| 306 | Ga0466706_118394 | 3300042599 | Bacteria | 4476 |
| 307 | Ga0466706_205175 | 3300042599 | Bacteria | 25168 |
| 308 | Ga0466700_294605 | 3300042600 | Unclassified | 4675 |
| 309 | Ga0466707_065365 | 3300042601 | Bacteria | 18517 |
| 310 | Ga0466707_318895 | 3300042601 | Bacteria | 29531 |
| 311 | Ga0466707_409906 | 3300042601 | Bacteria | 2118 |
| 312 | Ga0466713_056102 | 3300042602 | Bacteria | 4762 |
| 313 | Ga0466713_061976 | 3300042602 | Bacteria | 17861 |
| 314 | Ga0466716_405070 | 3300042605 | Unclassified | 2900 |
| 315 | Ga0466719_453825 | 3300042606 | Bacteria | 1853 |
| 316 | Ga0466721_022917 | 3300042608 | Bacteria | 9669 |
| 317 | Ga0466722_206268 | 3300042609 | Bacteria | 7683 |
| 318 | Ga0466690_101148 | 3300042590 | Bacteria | 6752 |
| 319 | Ga0466690_294800 | 3300042590 | Bacteria | 12770 |
| 320 | Ga0466691_122103 | 3300042593 | Bacteria | 4505 |
| 321 | Ga0466694_361415 | 3300042594 | Bacteria | 6275 |
| 322 | Ga0466695_329538 | 3300042595 | Unclassified | 1864 |
| 323 | Ga0466696_044313 | 3300042596 | Bacteria | 1182 |
| 324 | Ga0466696_365350 | 3300042596 | Bacteria | 1665 |
| 325 | Ga0466699_315371 | 3300042597 | Bacteria | 1357 |
| 326 | 2227097483 | 2225789004 | Bacteria | 9673 |
| 327 | IMNBL1DRAFT_c0000850 | 3300000062 | Bacteria | 23959 |
| 328 | IMNBL1DRAFT_c0001620 | 3300000062 | Bacteria | 16684 |
| 329 | IMNBL1DRAFT_c0005700 | 3300000062 | Bacteria | 7027 |
| 330 | HBC_ctgsDRAFT_1000008 | 3300000333 | Bacteria | 58706 |
| 331 | JGI24702J35022_10002224 | 3300002462 | Bacteria | 11933 |
| 332 | JGI24702J35022_10018894 | 3300002462 | Bacteria | 3754 |
| 333 | JGI24696J40584_12932366 | 3300002834 | Bacteria | 1501 |
| 334 | Ga0102734_1000373 | 3300007129 | Bacteria | 42767 |
| 335 | Ga0466705_079246 | 3300042612 | Bacteria | 6141 |
| 336 | Ga0466733_040979 | 3300042659 | Bacteria | 3191 |
| 337 | Ga0466733_045515 | 3300042659 | Unclassified | 2360 |
| 338 | Ga0466733_119391 | 3300042659 | Bacteria | 5663 |
| 339 | Ga0466733_159831 | 3300042659 | Bacteria | 3910 |
| 340 | Ga0466705_528787 | 3300042612 | Unclassified | 3399 |
| 341 | Ga0466710_420710 | 3300042613 | Bacteria | 2213 |
| 342 | Ga0466712_172895 | 3300042614 | Unclassified | 1889 |
| 343 | Ga0466711_053717 | 3300042615 | Bacteria | 8074 |
| 344 | Ga0466715_086418 | 3300042616 | Bacteria | 17729 |
| 345 | Ga0466715_471725 | 3300042616 | Bacteria | 9522 |
| 346 | Ga0466723_300139 | 3300042618 | Bacteria | 23484 |
| 347 | Ga0466723_305349 | 3300042618 | Bacteria | 16000 |
| 348 | Ga0466723_314144 | 3300042618 | Bacteria | 7620 |
| 349 | Ga0466726_068811 | 3300042619 | Bacteria | 4574 |
| 350 | Ga0466726_123542 | 3300042619 | Unclassified | 3786 |
| 351 | Ga0466726_133195 | 3300042619 | Bacteria | 1489 |
| 352 | Ga0466728_423170 | 3300042620 | Bacteria | 23735 |
| 353 | Ga0466729_095549 | 3300042621 | Bacteria | 14947 |
| 354 | Ga0466735_028137 | 3300042624 | Unclassified | 4681 |
| 355 | Ga0466735_087539 | 3300042624 | Bacteria | 6952 |
| 356 | Ga0466735_138212 | 3300042624 | Bacteria | 1237 |
| 357 | Ga0466735_192334 | 3300042624 | Bacteria | 3419 |
| 358 | Ga0466703_060142 | 3300042636 | Bacteria | 7596 |
| 359 | Ga0466703_112508 | 3300042636 | Bacteria | 13987 |
| 360 | Ga0466703_263616 | 3300042636 | Bacteria | 5051 |
| 361 | Ga0466704_419926 | 3300042643 | Bacteria | 34927 |
| 362 | Ga0466704_498990 | 3300042643 | Bacteria | 20830 |
| 363 | Ga0466709_159438 | 3300042648 | Bacteria | 10691 |
| 364 | Ga0466727_028886 | 3300042655 | Bacteria | 9072 |
| 365 | Ga0466727_210311 | 3300042655 | Bacteria | 3162 |
| 366 | Ga0123354_10219556 | 3300010882 | Bacteria | 2025 |
| 367 | Ga0466701_032343 | 3300042598 | Bacteria | 11792 |
| 368 | Ga0466706_154666 | 3300042599 | Bacteria | 17657 |
| 369 | Ga0466700_216462 | 3300042600 | Bacteria | 6334 |
| 370 | Ga0466707_327412 | 3300042601 | Bacteria | 33932 |
| 371 | Ga0466713_106122 | 3300042602 | Bacteria | 13962 |
| 372 | Ga0466719_010043 | 3300042606 | Unclassified | 1841 |
| 373 | Ga0466722_029780 | 3300042609 | Bacteria | 13820 |
| 374 | Ga0466722_080397 | 3300042609 | Bacteria | 11708 |
| 375 | Ga0466690_118775 | 3300042590 | Bacteria | 29964 |
| 376 | Ga0466690_188044 | 3300042590 | Bacteria | 53126 |
| 377 | Ga0466692_085757 | 3300042591 | Bacteria | 10543 |
| 378 | Ga0466691_028936 | 3300042593 | Bacteria | 12625 |
| 379 | Ga0466691_066150 | 3300042593 | Bacteria | 5895 |
| 380 | Ga0466696_123114 | 3300042596 | Bacteria | 18671 |
| 381 | Ga0466696_129222 | 3300042596 | Bacteria | 2200 |
| 382 | Ga0466696_159127 | 3300042596 | Bacteria | 18902 |
| 383 | Ga0466701_010990 | 3300042598 | Bacteria | 332169 |
| 384 | IMNBGM34_c000084 | 3300000036 | Bacteria | 26546 |
| 385 | JGI24705J35276_12206872 | 3300002504 | Bacteria | 1731 |
| 386 | JGI24705J35276_12211687 | 3300002504 | Unclassified | 1864 |
| 387 | Ga0068305_10193537 | 3300005083 | Bacteria | 6531 |
| 388 | Ga0466697_188719 | 3300042611 | Bacteria | 1796 |
| 389 | Ga0466705_266468 | 3300042612 | Bacteria | 9836 |
| 390 | Ga0466733_076024 | 3300042659 | Bacteria | 2884 |
| 391 | Ga0466733_081995 | 3300042659 | Bacteria | 115844 |
| 392 | Ga0466733_216697 | 3300042659 | Bacteria | 189231 |
| 393 | Ga0466711_152816 | 3300042615 | Bacteria | 26864 |
| 394 | Ga0466711_184042 | 3300042615 | Bacteria | 19299 |
| 395 | Ga0466715_039347 | 3300042616 | Bacteria | 8722 |
| 396 | Ga0466715_265890 | 3300042616 | Bacteria | 3979 |
| 397 | Ga0466715_394426 | 3300042616 | Bacteria | 7703 |
| 398 | Ga0466723_306549 | 3300042618 | Bacteria | 5686 |
| 399 | Ga0466728_093166 | 3300042620 | Bacteria | 80427 |
| 400 | Ga0466728_104915 | 3300042620 | Bacteria | 11625 |
| 401 | Ga0466728_399272 | 3300042620 | Bacteria | 209367 |
| 402 | Ga0466728_407563 | 3300042620 | Bacteria | 9708 |
| 403 | Ga0466729_099720 | 3300042621 | Bacteria | 12798 |
| 404 | Ga0466734_156847 | 3300042623 | Bacteria | 8515 |
| 405 | Ga0466735_000451 | 3300042624 | Bacteria | 15028 |
| 406 | Ga0466735_136155 | 3300042624 | Bacteria | 5236 |
| 407 | Ga0466735_149055 | 3300042624 | Bacteria | 3538 |
| 408 | Ga0466703_127347 | 3300042636 | Bacteria | 8766 |
| 409 | Ga0466703_162070 | 3300042636 | Bacteria | 8373 |
| 410 | Ga0466703_198136 | 3300042636 | Bacteria | 8558 |
| 411 | Ga0466703_323071 | 3300042636 | Bacteria | 8943 |
| 412 | Ga0466704_075247 | 3300042643 | Bacteria | 7265 |
| 413 | Ga0466704_092213 | 3300042643 | Bacteria | 1694 |
| 414 | Ga0466727_103787 | 3300042655 | Unclassified | 3716 |
| 415 | Ga0123357_10021662 | 3300009784 | Bacteria | 8604 |
| 416 | Ga0123353_10095263 | 3300010167 | Bacteria | 4796 |
| 417 | Ga0123353_10190447 | 3300010167 | Bacteria | 3238 |
| 418 | Ga0123354_10005803 | 3300010882 | Bacteria | 18104 |
| 419 | Ga0466706_024780 | 3300042599 | Bacteria | 27919 |
| 420 | Ga0466706_163906 | 3300042599 | Bacteria | 105365 |
| 421 | Ga0466700_156172 | 3300042600 | Bacteria | 109805 |
| 422 | Ga0466700_324238 | 3300042600 | Bacteria | 8189 |
| 423 | Ga0466707_044685 | 3300042601 | Bacteria | 4558 |
| 424 | Ga0466707_075455 | 3300042601 | Bacteria | 9140 |
| 425 | Ga0466707_410729 | 3300042601 | Bacteria | 18453 |
| 426 | Ga0466713_083515 | 3300042602 | Bacteria | 1398 |
| 427 | Ga0466713_092051 | 3300042602 | Bacteria | 141434 |
| 428 | Ga0466713_101917 | 3300042602 | Bacteria | 17048 |
| 429 | Ga0466713_129716 | 3300042602 | Bacteria | 104954 |
| 430 | Ga0466714_074068 | 3300042603 | Bacteria | 3058 |
| 431 | Ga0466714_112303 | 3300042603 | Bacteria | 6425 |
| 432 | Ga0466714_149966 | 3300042603 | Bacteria | 61855 |
| 433 | Ga0466717_171742 | 3300042604 | Bacteria | 3304 |
| 434 | Ga0466716_294797 | 3300042605 | Bacteria | 42169 |
| 435 | Ga0466716_366554 | 3300042605 | Bacteria | 7525 |
| 436 | Ga0466716_489751 | 3300042605 | Bacteria | 5117 |
| 437 | Ga0466719_149065 | 3300042606 | Bacteria | 2074 |
| 438 | Ga0466719_183506 | 3300042606 | Unclassified | 1436 |
| 439 | Ga0466719_294652 | 3300042606 | Bacteria | 3473 |
| 440 | Ga0466719_524611 | 3300042606 | Bacteria | 5022 |
| 441 | Ga0466722_065095 | 3300042609 | Bacteria | 3263 |
| 442 | Ga0466722_145590 | 3300042609 | Bacteria | 4418 |
| 443 | Ga0466657_039471 | 3300042582 | Bacteria | 1257 |
| 444 | Ga0466690_005627 | 3300042590 | Bacteria | 17343 |
| 445 | Ga0466690_105529 | 3300042590 | Bacteria | 20365 |
| 446 | Ga0466692_008187 | 3300042591 | Bacteria | 121981 |
| 447 | Ga0466692_110912 | 3300042591 | Bacteria | 24580 |
| 448 | Ga0466691_038415 | 3300042593 | Bacteria | 13725 |
| 449 | Ga0466691_149630 | 3300042593 | Bacteria | 3058 |
| 450 | Ga0466691_170836 | 3300042593 | Bacteria | 7650 |
| 451 | Ga0466696_029674 | 3300042596 | Bacteria | 8773 |
| 452 | Ga0466696_074748 | 3300042596 | Bacteria | 8699 |
| 453 | Ga0466696_105895 | 3300042596 | Bacteria | 3898 |
| 454 | Ga0466696_429124 | 3300042596 | Bacteria | 2605 |
| 455 | 2227488552 | 2225789004 | Bacteria | 4164 |
| 456 | 2227535760 | 2225789004 | Bacteria | 15949 |
| 457 | JGI24698J34947_10064785 | 3300002449 | Bacteria | 1784 |
| 458 | JGI24699J35502_11133821 | 3300002509 | Bacteria | 16389 |
| 459 | Ga0068302_10111956 | 3300005071 | Bacteria | 7815 |
| 460 | Ga0104048_1025103 | 3300007143 | Bacteria | 3471 |
| 461 | Ga0103264_1000101 | 3300007188 | Bacteria | 49856 |
| 462 | Ga0127649_100531 | 3300009460 | Bacteria | 18197 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.