Protein Family IF03057

Metagenome Isolate
160 Members
63 Samples
132 Scaffolds
314.09 Avg Length

🧬 Representative Sequence

ID
3300010167|Ga0123353_10009398|Ga0123353_100093987
Length
394 aa
Sequence
VVFLDNVPRAGWKADNSPAWRGGREADGVVXXXXDTRGGVDSFLGFRLTGGFRCDTIPWLFFTEGKESPMIELAGIHKTFRVARRQAGFGRAVKALFSREVELVHALTDVNFTIRDGEMVGYIGPNGAGKSTTIKIMCGILTPDSGVCEIDGRTPWKERVAHVREIGVVFGQRSQLWWDVPVIDSFELIRDIYKVGANLYKRNLDELTALLDLEEIVKTPARSLSLGQRMRCEIAASLLHSPRTLFLDEPTIGLDAVSKIAVRQFIKKLSAEHGTTVILTTHDMQDIEALTERILLIGKGRILLDGGLAELKKRSSERKTLVIEHSGGAPALCEGMALCEEKEGRLVVALDPSVLSVSEAIARLAAQTEINDISVSDITAEEMVAALYREYQI*

📊 Sample Types

Isolate 17.5%
Metagenome 82.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 40.3%
Termitidae 35.5%
Kalotermitidae 16.1%
Hodotermitidae 1.6%
Scarabaeidae 1.6%
Rhinotermitidae 1.6%
Passalidae 1.6%
Dytiscidae 1.6%

🌳 Taxonomy

Archaea 0
Bacteria 155
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125650 Treponema sp. Co191P3bin64 Isolate Unclassified
2 2820229114 Unclassified Firmicutes Th196P4bin40 Isolate Unclassified
3 2820290662 Unclassified Firmicutes Th196P3bin135 Isolate Unclassified
4 2820353569 Unclassified Firmicutes Nt197P3bin28 Isolate Unclassified
5 2820420508 Unclassified Firmicutes Lab288P3bin68 Isolate Unclassified
6 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
7 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
8 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
9 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
10 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
11 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
12 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
13 2820854745 Unclassified Actinobacteria Lab288P3bin234 Isolate Unclassified
14 2585428085 Sporobacter termitidis DSM 10068 Isolate Termitidae
15 2820227065 Unclassified Firmicutes Th196P4bin44 Isolate Unclassified
16 2820435670 Unclassified Firmicutes Lab288P3bin217 Isolate Unclassified
17 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
18 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
19 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
20 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
21 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
22 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
23 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
24 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
25 2820825283 Unclassified Actinobacteria Nt197P3bin111 Isolate Unclassified
26 2820547636 Unclassified Firmicutes Lab288P1bin10 Isolate Unclassified
27 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
28 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
29 2852337885 Paenibacillus protaetiae FW100M-2 Isolate Scarabaeidae
30 2820282995 Unclassified Firmicutes Th196P3bin147 Isolate Unclassified
31 2820329821 Unclassified Firmicutes Nt197P3bin77 Isolate Unclassified
32 2820576413 Unclassified Firmicutes Emb289P3bin136 Isolate Unclassified
33 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
34 2820238527 Unclassified Firmicutes Th196P3bin90 Isolate Unclassified
35 2820348946 Unclassified Firmicutes Nt197P3bin47 Isolate Unclassified
36 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
37 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
38 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
39 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
40 8018794549 Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 Isolate
41 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
42 2820371985 Unclassified Firmicutes Nt197P3bin100 Isolate Unclassified
43 2820654856 Unclassified Firmicutes Cu122P1bin2 Isolate Unclassified
44 2820702360 Unclassified Firmicutes Co191P1bin4 Isolate Unclassified
45 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
46 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
47 2820800812 Unclassified Actinobacteria Th196P4bin28 Isolate Unclassified
48 2820246658 Unclassified Firmicutes Th196P3bin70 Isolate Unclassified
49 2820267566 Unclassified Firmicutes Th196P3bin33 Isolate Unclassified
50 2820336130 Unclassified Firmicutes Nt197P3bin70 Isolate Unclassified
51 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
52 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
53 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
54 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
55 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
56 2873593402 Erysipelothrix sp. HDW6A Isolate Dytiscidae
57 2820472365 Unclassified Firmicutes Lab288P1bin87 Isolate Unclassified
58 2820563109 Unclassified Firmicutes Emb289P3bin58 Isolate Unclassified
59 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
60 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
61 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
62 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
63 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466702_255697 3300042635 Bacteria 5575
2 Ga0466703_145380 3300042636 Bacteria 7606
3 Ga0466706_032296 3300042599 Bacteria 2143
4 Ga0466714_032719 3300042603 Bacteria 4212
5 Ga0466721_102600 3300042608 Bacteria 1845
6 Ga0466705_464923 3300042612 Bacteria 107405
7 Ga0466718_121877 3300042617 Bacteria 1409
8 Ga0123355_10044014 3300009826 Bacteria 7264
9 Ga0123355_10096125 3300009826 Bacteria 4680
10 Ga0123355_10754398 3300009826 Bacteria 1099
11 Ga0123356_10035636 3300010049 Bacteria 4647
12 Ga0123356_10123456 3300010049 Bacteria 2524
13 Ga0123353_10023145 3300010167 Bacteria 9397
14 Ga0123353_10064671 3300010167 Bacteria 5871
15 Ga0123353_10179440 3300010167 Bacteria 3354
16 Ga0123353_10197881 3300010167 Bacteria 3165
17 Ga0123354_10450053 3300010882 Bacteria 1044
18 JGI24703J35330_11748607 3300002501 Bacteria 21865
19 Ga0466703_019738 3300042636 Bacteria 41879
20 Ga0466725_047440 3300042654 Bacteria 2632
21 Ga0466725_272926 3300042654 Bacteria 2104
22 Ga0466698_127748 3300042610 Bacteria 1901
23 Ga0123355_10000319 3300009826 Bacteria 61820
24 Ga0123355_10161252 3300009826 Bacteria 3378
25 Ga0123355_10347435 3300009826 Bacteria 1969
26 Ga0123356_10000942 3300010049 Bacteria 32205
27 Ga0123356_10017513 3300010049 Bacteria 6816
28 Ga0123353_10138870 3300010167 Bacteria 3895
29 Ga0123353_10251845 3300010167 Bacteria 2734
30 Ga0123353_10457479 3300010167 Bacteria 1877
31 Ga0123353_10487712 3300010167 Bacteria 1801
32 Ga0123354_10041172 3300010882 Bacteria 7141
33 JGI24702J35022_10001085 3300002462 Bacteria 16932
34 Ga0466705_112134 3300042612 Bacteria 69988
35 Ga0466714_065722 3300042603 Bacteria 1961
36 Ga0466717_007877 3300042604 Bacteria 8770
37 Ga0123357_10037814 3300009784 Bacteria 6570
38 Ga0123355_10016922 3300009826 Bacteria 11503
39 Ga0123353_10007132 3300010167 Bacteria 15048
40 Ga0123353_10026110 3300010167 Bacteria 8913
41 Ga0466691_008700 3300042593 Bacteria 6236
42 JGI24705J35276_12195354 3300002504 Bacteria 1524
43 Ga0466705_365220 3300042612 Bacteria 1996
44 Ga0466733_070219 3300042659 Bacteria 3421
45 Ga0466702_015081 3300042635 Bacteria 1260
46 Ga0466704_020045 3300042643 Bacteria 3477
47 Ga0466708_385803 3300042652 Bacteria 6215
48 Ga0466706_260991 3300042599 Unclassified 2399
49 Ga0466717_233913 3300042604 Bacteria 2467
50 Ga0466718_018855 3300042617 Bacteria 1368
51 Ga0466718_144245 3300042617 Bacteria 2260
52 Ga0466728_274561 3300042620 Bacteria 4501
53 Ga0123355_10090464 3300009826 Bacteria 4855
54 Ga0123355_10118198 3300009826 Bacteria 4120
55 Ga0123355_10408928 3300009826 Bacteria 1743
56 Ga0123353_10119203 3300010167 Bacteria 4244
57 IMNBL1DRAFT_c0004267 3300000062 Bacteria 8653
58 JGI24696J40584_12942106 3300002834 Unclassified 1729
59 Ga0466704_510194 3300042643 Unclassified 1330
60 Ga0466713_147824 3300042602 Bacteria 2256
61 Ga0466714_053800 3300042603 Bacteria 1450
62 Ga0466721_250610 3300042608 Unclassified 2565
63 Ga0123355_10000114 3300009826 Bacteria 90963
64 Ga0123355_10006192 3300009826 Bacteria 17669
65 Ga0123355_10021263 3300009826 Bacteria 10383
66 Ga0123355_10282616 3300009826 Bacteria 2289
67 Ga0123355_10396500 3300009826 Bacteria 1784
68 Ga0123355_10643757 3300009826 Bacteria 1240
69 Ga0123356_10003321 3300010049 Bacteria 16883
70 Ga0123356_10331366 3300010049 Bacteria 1639
71 Ga0123356_10353910 3300010049 Bacteria 1593
72 Ga0123356_10420553 3300010049 Bacteria 1478
73 Ga0123353_10284804 3300010167 Bacteria 2535
74 Ga0466693_046040 3300042592 Bacteria 2785
75 IMNBL1DRAFT_c0013016 3300000062 Bacteria 3763
76 JGI24695J34938_10000267 3300002450 Bacteria 50738
77 JGI24702J35022_10005689 3300002462 Bacteria 7264
78 JGI24702J35022_10010650 3300002462 Bacteria 5137
79 Ga0466705_306648 3300042612 Bacteria 5175
80 Ga0466731_060585 3300042622 Bacteria 2356
81 Ga0466706_150183 3300042599 Unclassified 15248
82 Ga0466719_226791 3300042606 Bacteria 6608
83 Ga0466721_177485 3300042608 Bacteria 16105
84 Ga0466718_158317 3300042617 Bacteria 2187
85 Ga0123355_10000141 3300009826 Bacteria 86040
86 Ga0123355_10003676 3300009826 Bacteria 22119
87 Ga0123355_10004854 3300009826 Bacteria 19573
88 Ga0123355_10115049 3300009826 Bacteria 4190
89 Ga0123355_10476322 3300009826 Bacteria 1556
90 Ga0123356_10289665 3300010049 Bacteria 1737
91 Ga0123353_10000556 3300010167 Bacteria 45840
92 Ga0123353_10026144 3300010167 Bacteria 8909
93 Ga0123353_10049745 3300010167 Bacteria 6678
94 Ga0123353_10160556 3300010167 Bacteria 3579
95 Ga0466690_208398 3300042590 Bacteria 2919
96 JGI24702J35022_10000169 3300002462 Bacteria 34308
97 Ga0466733_028126 3300042659 Bacteria 1739
98 Ga0466731_294200 3300042622 Bacteria 2210
99 Ga0466704_025614 3300042643 Bacteria 9149
100 Ga0466714_105508 3300042603 Bacteria 1283
101 Ga0466717_004852 3300042604 Bacteria 1446
102 Ga0466717_215884 3300042604 Bacteria 3969
103 Ga0466721_143896 3300042608 Bacteria 1455
104 Ga0466722_136743 3300042609 Bacteria 57023
105 Ga0123355_10002295 3300009826 Bacteria 27035
106 Ga0123355_10093317 3300009826 Bacteria 4765
107 Ga0123355_10098991 3300009826 Bacteria 4596
108 Ga0123355_10288536 3300009826 Bacteria 2255
109 Ga0123356_10102502 3300010049 Bacteria 2748
110 Ga0123353_10009398 3300010167 Bacteria 13492
111 JGI24695J34938_10000701 3300002450 Bacteria 31525
112 Ga0466705_239567 3300042612 Bacteria 3692
113 Ga0466706_226117 3300042599 Bacteria 4395
114 Ga0466714_130616 3300042603 Bacteria 1116
115 Ga0466717_210281 3300042604 Bacteria 2544
116 Ga0466719_484306 3300042606 Bacteria 1722
117 Ga0466711_233007 3300042615 Bacteria 3925
118 Ga0466715_429206 3300042616 Bacteria 39560
119 Ga0123355_10001643 3300009826 Bacteria 31165
120 Ga0123355_10019314 3300009826 Bacteria 10850
121 Ga0123355_10130052 3300009826 Bacteria 3881
122 Ga0123355_10252279 3300009826 Bacteria 2482
123 Ga0123355_10369300 3300009826 Bacteria 1881
124 Ga0123355_10699536 3300009826 Bacteria 1164
125 Ga0123355_10712442 3300009826 Bacteria 1148
126 Ga0123356_10035108 3300010049 Bacteria 4686
127 Ga0123353_10019922 3300010167 Bacteria 9993
128 Ga0123353_10044079 3300010167 Bacteria 7071
129 Ga0123353_10147349 3300010167 Bacteria 3762
130 Ga0123353_10391970 3300010167 Bacteria 2071
131 Ga0415639_001596 3300038395 Bacteria 16462
132 Ga0415639_153862 3300038395 Bacteria 2196

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00005 ABC_tran ABC transporter 107 251 0.9
PF13304 AAA_21 AAA domain, putative AbiEii toxin, Type IV TA system 215 283 0.85

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.