Protein Family IF03030
Metagenome
Metatranscriptome
Isolate
125
Members
71
Samples
109
Scaffolds
259.26
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_10000970|Ga0123353_1000097010
- Length
- 295 aa
- Sequence
- MPIAALKSVLAYGKIIKIFLQIWYVTKLFLYFCRPKKIVMQSFQKLLGIMDELRAKCPWDSKQTFDSLRYLTIEETYELSDAIIDKKYIDISKELGDLLLHIVFYAKIGEEENLFNIETVIEGICEKLIRRHPHIFGEVHVNSVDEVKGNWEKIKLKEGSKSVLGGVPNSLPAMVKAYRIQEKARGVGFDWENTEQVWEKVQEELSEFNRERSLNSEKMEDEFGDILFALINYARFININPEDALEKTNRKFIQRFNFIEKKAKEMDKPLSEMSLYEIEGLWQQAKCVNMVHYT*
Sample Types
Isolate
12.8%
Metagenome
86.4%
MAG
0.0%
Metatranscriptome
0.8%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
36.4%
Unclassified
18.2%
Kalotermitidae
12.1%
Formicidae
9.1%
Armadillidiidae
7.6%
Drosophilidae
6.1%
Rhinotermitidae
1.5%
Hodotermitidae
1.5%
Daphniidae
1.5%
Elmidae
1.5%
Passalidae
1.5%
Termopsidae
1.5%
Bombycidae
1.5%
Taxonomy
Archaea
1
Bacteria
118
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820755292 | Unclassified Bacteroidetes Nc150P3bin3 | Isolate | Unclassified |
| 2 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 3 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 4 | 2820795054 | Unclassified Bacteroidetes Cu122P1bin21 | Isolate | Unclassified |
| 5 | 2896321640 | Sphingobacterium sp. xlx-130 | Isolate | |
| 6 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 7 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 8 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 9 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 10 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 11 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 12 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 13 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 14 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 15 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 16 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 17 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 18 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 19 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 20 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 21 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 22 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 23 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 24 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 25 | 2820750388 | Unclassified Bacteroidetes Nt197P3bin50 | Isolate | Unclassified |
| 26 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 27 | 2820783511 | Unclassified Bacteroidetes Emb289P3bin108 | Isolate | Unclassified |
| 28 | 2898741527 | Sphingobacterium sp. xlx-73 | Isolate | |
| 29 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 30 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 31 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 32 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 33 | 2590828803 | Pedobacter glucosidilyticus DD6b | Isolate | Daphniidae |
| 34 | 2820741847 | Unclassified Bacteroidetes Th196P3bin71 | Isolate | Unclassified |
| 35 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 36 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 37 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 38 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 39 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 40 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 41 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 42 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 43 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 44 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 45 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 46 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 47 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 48 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 49 | 2864836148 | Arcicella rosea S00070 | Isolate | Elmidae |
| 50 | 2896330536 | Sphingobacterium sp. xlx-96 | Isolate | |
| 51 | 2820735654 | Unclassified Bacteroidetes Th196P4bin9 | Isolate | Unclassified |
| 52 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 53 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 54 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 55 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 56 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 57 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 58 | 2820753519 | Unclassified Bacteroidetes Nc150P4bin20 | Isolate | Unclassified |
| 59 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 60 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 61 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 62 | 2820797595 | Unclassified Bacteroidetes Co191P3bin3 | Isolate | Unclassified |
| 63 | 2896350215 | Sphingobacterium sp. xlx-183 | Isolate | |
| 64 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 65 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 66 | 2579779088 | Sphingobacterium paucimobilis HER1398 | Isolate | Bombycidae |
| 67 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 68 | 3300007733 | Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean | Metagenome | |
| 69 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 70 | 3300022815 | Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA | Metatranscriptome | Termitidae |
| 71 | 2820792843 | Unclassified Bacteroidetes Cu122P3bin1 | Isolate | Unclassified |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_187289 | 3300042656 | Bacteria | 8588 |
| 2 | Ga0466713_096519 | 3300042602 | Bacteria | 5095 |
| 3 | Ga0466722_245526 | 3300042609 | Bacteria | 18049 |
| 4 | Ga0123356_10001463 | 3300010049 | Bacteria | 26026 |
| 5 | Ga0466724_30485 | 3300042649 | Bacteria | 5981 |
| 6 | Ga0466724_56165 | 3300042649 | Bacteria | 3545 |
| 7 | IMNBL1DRAFT_c0033881 | 3300000062 | Bacteria | 1824 |
| 8 | JGI24695J34938_10009726 | 3300002450 | Bacteria | 5326 |
| 9 | JGI24696J40584_12832720 | 3300002834 | Bacteria | 934 |
| 10 | Ga0104048_1003348 | 3300007143 | Bacteria | 6272 |
| 11 | Ga0160445_100451 | 3300012847 | Bacteria | 21357 |
| 12 | Ga0466701_015025 | 3300042598 | Bacteria | 1676 |
| 13 | Ga0123353_10340566 | 3300010167 | Bacteria | 2265 |
| 14 | Ga0160444_100029 | 3300012841 | Bacteria | 247585 |
| 15 | Ga0466657_398260 | 3300042582 | Bacteria | 14596 |
| 16 | Ga0466694_061481 | 3300042594 | Bacteria | 40983 |
| 17 | Ga0466694_187261 | 3300042594 | Bacteria | 3374 |
| 18 | Ga0466707_351705 | 3300042601 | Bacteria | 2336 |
| 19 | Ga0466713_059293 | 3300042602 | Bacteria | 25779 |
| 20 | Ga0466717_138833 | 3300042604 | Archaea | 1185 |
| 21 | Ga0466722_167806 | 3300042609 | Bacteria | 4258 |
| 22 | Ga0123356_10005344 | 3300010049 | Bacteria | 13093 |
| 23 | Ga0123356_11406288 | 3300010049 | Unclassified | 858 |
| 24 | Ga0123354_10491188 | 3300010882 | Bacteria | 964 |
| 25 | Ga0466710_009503 | 3300042613 | Bacteria | 4149 |
| 26 | Ga0466728_059165 | 3300042620 | Bacteria | 4779 |
| 27 | Ga0466731_422518 | 3300042622 | Bacteria | 9244 |
| 28 | Ga0466703_003699 | 3300042636 | Bacteria | 2660 |
| 29 | JGI24702J35022_10014868 | 3300002462 | Bacteria | 4287 |
| 30 | Ga0068305_10087821 | 3300005083 | Bacteria | 7893 |
| 31 | Ga0102734_1001033 | 3300007129 | Bacteria | 12981 |
| 32 | Ga0123353_10001157 | 3300010167 | Bacteria | 32209 |
| 33 | Ga0123353_10057013 | 3300010167 | Bacteria | 6255 |
| 34 | Ga0466710_447233 | 3300042613 | Bacteria | 15547 |
| 35 | Ga0466715_610873 | 3300042616 | Bacteria | 1499 |
| 36 | Ga0466724_34635 | 3300042649 | Bacteria | 4564 |
| 37 | Ga0466724_47776 | 3300042649 | Bacteria | 343411 |
| 38 | Ga0466708_040388 | 3300042652 | Bacteria | 5342 |
| 39 | IMNBL1DRAFT_c0012331 | 3300000062 | Bacteria | 3915 |
| 40 | JGI24702J35022_10004721 | 3300002462 | Bacteria | 8066 |
| 41 | JGI24705J35276_12124342 | 3300002504 | Bacteria | 1082 |
| 42 | CVPL010W_10000188 | 3300002931 | Bacteria | 54171 |
| 43 | Ga0104048_1026468 | 3300007143 | Unclassified | 2715 |
| 44 | Ga0103267_1000554 | 3300007190 | Bacteria | 18912 |
| 45 | Ga0160445_100437 | 3300012847 | Bacteria | 21840 |
| 46 | Ga0466697_123228 | 3300042611 | Bacteria | 1309 |
| 47 | Ga0466697_165412 | 3300042611 | Bacteria | 1766 |
| 48 | Ga0466701_019509 | 3300042598 | Bacteria | 3212 |
| 49 | Ga0466722_122971 | 3300042609 | Bacteria | 1409 |
| 50 | Ga0123353_10007052 | 3300010167 | Bacteria | 15115 |
| 51 | Ga0466710_182123 | 3300042613 | Bacteria | 1452 |
| 52 | Ga0466710_223092 | 3300042613 | Bacteria | 1596 |
| 53 | Ga0466711_431887 | 3300042615 | Bacteria | 12612 |
| 54 | Ga0466723_083927 | 3300042618 | Bacteria | 3744 |
| 55 | JGI24696J40584_12961016 | 3300002834 | Bacteria | 10006 |
| 56 | Ga0104045_1006675 | 3300007085 | Unclassified | 7601 |
| 57 | Ga0102740_1000395 | 3300007140 | Bacteria | 12079 |
| 58 | Ga0104019_1007309 | 3300007150 | Bacteria | 7221 |
| 59 | Ga0104050_1000131 | 3300007153 | Bacteria | 7229 |
| 60 | Ga0103268_1000197 | 3300007192 | Bacteria | 19849 |
| 61 | Ga0160457_1003096 | 3300012858 | Bacteria | 3038 |
| 62 | Ga0466693_374630 | 3300042592 | Bacteria | 2824 |
| 63 | Ga0466701_040490 | 3300042598 | Bacteria | 26650 |
| 64 | Ga0466701_070524 | 3300042598 | Bacteria | 2855 |
| 65 | Ga0466713_048311 | 3300042602 | Bacteria | 71291 |
| 66 | Ga0466722_149797 | 3300042609 | Bacteria | 3799 |
| 67 | Ga0123357_10228474 | 3300009784 | Bacteria | 2046 |
| 68 | Ga0123356_10462380 | 3300010049 | Bacteria | 1419 |
| 69 | Ga0123356_10557794 | 3300010049 | Bacteria | 1307 |
| 70 | Ga0123353_10005456 | 3300010167 | Bacteria | 16705 |
| 71 | Ga0123353_10836714 | 3300010167 | Bacteria | 1264 |
| 72 | Ga0123354_10112532 | 3300010882 | Bacteria | 3583 |
| 73 | Ga0123354_10180315 | 3300010882 | Unclassified | 2414 |
| 74 | Ga0466715_282265 | 3300042616 | Bacteria | 5359 |
| 75 | IMNBL1DRAFT_c0055812 | 3300000062 | Bacteria | 1215 |
| 76 | Ga0104045_1082208 | 3300007085 | Bacteria | 1070 |
| 77 | Ga0160433_112596 | 3300012846 | Bacteria | 1063 |
| 78 | Ga0466733_067741 | 3300042659 | Bacteria | 8494 |
| 79 | Ga0466701_086544 | 3300042598 | Bacteria | 103634 |
| 80 | Ga0466706_183423 | 3300042599 | Bacteria | 13844 |
| 81 | Ga0466713_036964 | 3300042602 | Bacteria | 29926 |
| 82 | Ga0466720_023256 | 3300042607 | Bacteria | 2268 |
| 83 | Ga0466698_204559 | 3300042610 | Bacteria | 4613 |
| 84 | Ga0123353_10000970 | 3300010167 | Bacteria | 35107 |
| 85 | Ga0123353_10082174 | 3300010167 | Bacteria | 5182 |
| 86 | Ga0123353_10483148 | 3300010167 | Bacteria | 1812 |
| 87 | Ga0123353_10841123 | 3300010167 | Bacteria | 1260 |
| 88 | Ga0466735_211536 | 3300042624 | Bacteria | 3484 |
| 89 | Ga0466730_030722 | 3300042625 | Bacteria | 1135247 |
| 90 | Ga0104048_1022177 | 3300007143 | Bacteria | 9845 |
| 91 | Ga0103267_1000559 | 3300007190 | Bacteria | 11944 |
| 92 | Ga0160444_102408 | 3300012841 | Unclassified | 2891 |
| 93 | Ga0160443_100077 | 3300012848 | Bacteria | 175780 |
| 94 | Ga0255786_1040200 | 3300022815 | Bacteria | 1407 |
| 95 | Ga0466693_074493 | 3300042592 | Bacteria | 1307 |
| 96 | Ga0466694_025681 | 3300042594 | Bacteria | 6210 |
| 97 | Ga0466701_032205 | 3300042598 | Bacteria | 2965 |
| 98 | Ga0466707_128851 | 3300042601 | Bacteria | 14806 |
| 99 | Ga0123356_10026071 | 3300010049 | Bacteria | 5495 |
| 100 | Ga0123353_11040846 | 3300010167 | Bacteria | 1095 |
| 101 | Ga0123354_10005583 | 3300010882 | Bacteria | 18345 |
| 102 | Ga0123354_10238205 | 3300010882 | Bacteria | 1880 |
| 103 | Ga0103263_103562 | 3300007042 | Bacteria | 1850 |
| 104 | Ga0104050_1002559 | 3300007153 | Bacteria | 2210 |
| 105 | Ga0104050_1027380 | 3300007153 | Unclassified | 1793 |
| 106 | Ga0105524_106074 | 3300007733 | Bacteria | 1353 |
| 107 | Ga0466691_111772 | 3300042593 | Bacteria | 94015 |
| 108 | Ga0466695_365501 | 3300042595 | Bacteria | 1282 |
| 109 | Ga0466696_298181 | 3300042596 | Bacteria | 4924 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF03819 | MazG | MazG nucleotide pyrophosphohydrolase domain | 63 | 136 | 0.99 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.