Protein Family IF03001

Metagenome Metatranscriptome Isolate
141 Members
57 Samples
132 Scaffolds
87.06 Avg Length

🧬 Representative Sequence

ID
3300010049|Ga0123356_13588489|Ga0123356_135884892
Length
100 aa
Sequence
MQKA*TDDAWVDYLHWQSQDKKTLKKINEIIKDIDRQPFNGIGKPEPLKGDKHGYWSRRIDYANRIIYKIENEQLIIIQCGGHYDDS*DDSILGSLLET*

📊 Sample Types

Isolate 6.4%
Metagenome 92.2%
MAG 0.0%
Metatranscriptome 1.4%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 58.2%
Unclassified 14.5%
Kalotermitidae 12.7%
Rhinotermitidae 5.5%
Passalidae 3.6%
Termopsidae 1.8%
Aphididae 1.8%
Hodotermitidae 1.8%

🌳 Taxonomy

Archaea 0
Bacteria 125
Eukaryota 0
Viruses 0
Unclassified 16

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820822094 Unclassified Actinobacteria Nt197P3bin131 Isolate Unclassified
2 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
3 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
4 2820220859 Unclassified Firmicutes Th196P4bin59 Isolate Unclassified
5 2820429680 Unclassified Firmicutes Lab288P3bin30 Isolate Unclassified
6 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
7 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
8 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
9 3300021244 Termite gut microbial communities from nest from French Guiana - 12-6 mRNA SA Metatranscriptome Termitidae
10 2820267566 Unclassified Firmicutes Th196P3bin33 Isolate Unclassified
11 2820580397 Unclassified Firmicutes Emb289P3bin133 Isolate Unclassified
12 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
13 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
14 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
15 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
16 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
17 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
18 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
19 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
20 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
21 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
22 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
23 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
24 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
25 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
26 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
27 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
28 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
29 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
30 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
31 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
32 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
33 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
34 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
35 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
36 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
37 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
38 644736334 Candidatus Hamiltonella defensa 5AT Isolate Aphididae
39 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
40 2820275298 Unclassified Firmicutes Th196P3bin17 Isolate Unclassified
41 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
42 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
43 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
44 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
45 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
46 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
47 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
48 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
49 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
50 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
51 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
52 3300021190 Termite gut microbial communities from nest - French Guiana - 1_3 mRNA 1_3 mRNA SA Metatranscriptome Termitidae
53 2820414148 Unclassified Firmicutes Lab288P3bin93 Isolate Unclassified
54 2820731983 Unclassified Chloroflexi Nt197P3bin126 Isolate Unclassified
55 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
56 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
57 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466697_072413 3300042611 Bacteria 1277
2 Ga0123356_10010787 3300010049 Bacteria 8940
3 Ga0123356_10301635 3300010049 Unclassified 1707
4 Ga0123353_10006043 3300010167 Bacteria 16042
5 Ga0123353_10044647 3300010167 Bacteria 7027
6 Ga0123353_10087257 3300010167 Bacteria 5026
7 Ga0123353_10966809 3300010167 Bacteria 1149
8 Ga0123353_12091972 3300010167 Unclassified 689
9 Ga0264413_126103 3300024493 Bacteria 1048
10 Ga0415639_022312 3300038395 Bacteria 6752
11 Ga0466695_108738 3300042595 Bacteria 4150
12 Ga0466714_097028 3300042603 Bacteria 2207
13 Ga0466717_127137 3300042604 Bacteria 1474
14 Ga0466722_089100 3300042609 Bacteria 1277
15 JGI24695J34938_10024523 3300002450 Bacteria 2896
16 JGI24695J34938_10376194 3300002450 Bacteria 629
17 JGI24696J40584_12554863 3300002834 Unclassified 628
18 Ga0072941_1014958 3300005201 Bacteria 28338
19 Ga0123355_10102640 3300009826 Bacteria 4497
20 Ga0123356_11658514 3300010049 Bacteria 792
21 Ga0123356_13436461 3300010049 Bacteria 549
22 Ga0123353_10432583 3300010167 Bacteria 1945
23 Ga0123353_10606320 3300010167 Unclassified 1563
24 Ga0123353_11479773 3300010167 Bacteria 867
25 Ga0466706_237354 3300042599 Bacteria 4842
26 Ga0466714_164919 3300042603 Bacteria 1706
27 Ga0466698_067466 3300042610 Bacteria 1286
28 Ga0466702_132053 3300042635 Bacteria 1362
29 2227488537 2225789004 Bacteria 20667
30 2227508943 2225789004 Bacteria 708
31 JGI24702J35022_10012529 3300002462 Bacteria 4710
32 JGI24702J35022_10611165 3300002462 Bacteria 675
33 Ga0123357_10155621 3300009784 Bacteria 2758
34 Ga0123356_11254737 3300010049 Bacteria 906
35 Ga0123353_10003083 3300010167 Bacteria 20883
36 Ga0123353_10037459 3300010167 Bacteria 7609
37 Ga0123353_10065409 3300010167 Bacteria 5837
38 Ga0123353_11229276 3300010167 Bacteria 980
39 Ga0123354_10118402 3300010882 Bacteria 3439
40 Ga0123354_10444705 3300010882 Unclassified 1055
41 Ga0466694_319594 3300042594 Bacteria 7161
42 Ga0466699_221564 3300042597 Bacteria 2968
43 Ga0466723_006565 3300042618 Bacteria 1225
44 Ga0466719_261172 3300042606 Bacteria 2997
45 JGI24703J35330_10969415 3300002501 Unclassified 615
46 JGI24705J35276_12180783 3300002504 Bacteria 1367
47 Ga0466733_011840 3300042659 Unclassified 2985
48 Ga0123355_10740614 3300009826 Unclassified 1115
49 Ga0123356_10063333 3300010049 Bacteria 3455
50 Ga0123356_10731231 3300010049 Bacteria 1159
51 Ga0123356_13588489 3300010049 Bacteria 537
52 Ga0123356_13993909 3300010049 Bacteria 508
53 Ga0123353_10183189 3300010167 Bacteria 3313
54 Ga0123353_10764041 3300010167 Bacteria 1342
55 Ga0466693_073382 3300042592 Bacteria 1293
56 Ga0466728_267858 3300042620 Bacteria 2951
57 Ga0466700_476101 3300042600 Bacteria 1128
58 Ga0466714_103198 3300042603 Bacteria 1317
59 Ga0466722_260627 3300042609 Bacteria 8104
60 JGI24702J35022_10122269 3300002462 Bacteria 1438
61 Ga0072940_1416669 3300005200 Bacteria 1447
62 Ga0466733_066909 3300042659 Bacteria 1732
63 Ga0123355_10128152 3300009826 Bacteria 3916
64 Ga0123356_12194152 3300010049 Bacteria 690
65 Ga0123353_10299071 3300010167 Bacteria 2458
66 Ga0123353_10344507 3300010167 Unclassified 2249
67 Ga0123353_10886582 3300010167 Unclassified 1217
68 Ga0123353_11306560 3300010167 Bacteria 941
69 Ga0123353_13398385 3300010167 Bacteria 505
70 Ga0466691_033180 3300042593 Bacteria 1246
71 Ga0466699_093995 3300042597 Bacteria 2874
72 JGI24698J34947_10194188 3300002449 Unclassified 801
73 JGI24695J34938_10029386 3300002450 Bacteria 2572
74 JGI24699J35502_10509164 3300002509 Unclassified 622
75 Ga0123355_10001216 3300009826 Bacteria 35872
76 Ga0123355_10002517 3300009826 Bacteria 25946
77 Ga0123355_10438044 3300009826 Bacteria 1657
78 Ga0123356_11129968 3300010049 Bacteria 951
79 Ga0123356_12477740 3300010049 Bacteria 649
80 Ga0222431_1034256 3300021190 Bacteria 565
81 Ga0223686_1118081 3300021244 Bacteria 878
82 Ga0466694_313269 3300042594 Bacteria 1265
83 Ga0466695_200795 3300042595 Bacteria 1177
84 Ga0466699_205118 3300042597 Bacteria 2389
85 Ga0466715_151092 3300042616 Bacteria 2356
86 Ga0466726_345272 3300042619 Bacteria 1183
87 Ga0466729_299856 3300042621 Bacteria 2171
88 Ga0466734_163898 3300042623 Bacteria 1144
89 Ga0466702_158998 3300042635 Bacteria 1693
90 JGI24695J34938_10016776 3300002450 Bacteria 3714
91 JGI24695J34938_10041942 3300002450 Bacteria 2051
92 JGI24702J35022_10001399 3300002462 Bacteria 15013
93 JGI24702J35022_10052928 3300002462 Bacteria 2164
94 JGI24699J35502_11033590 3300002509 Unclassified 1526
95 Ga0123355_10055384 3300009826 Bacteria 6422
96 Ga0123355_11726632 3300009826 Unclassified 595
97 Ga0123356_10023336 3300010049 Bacteria 5823
98 Ga0123356_10642449 3300010049 Bacteria 1228
99 Ga0123356_11602946 3300010049 Bacteria 806
100 Ga0123353_10561858 3300010167 Bacteria 1643
101 Ga0123353_11583082 3300010167 Bacteria 829
102 Ga0123353_11613293 3300010167 Bacteria 818
103 Ga0123353_12542129 3300010167 Bacteria 608
104 Ga0415639_103859 3300038395 Bacteria 1425
105 Ga0466692_073922 3300042591 Bacteria 1351
106 Ga0466712_033748 3300042614 Bacteria 14790
107 Ga0466726_084102 3300042619 Bacteria 1895
108 Ga0466721_276295 3300042608 Bacteria 1339
109 Ga0466731_220428 3300042622 Bacteria 1945
110 IMNBL1DRAFT_c0084134 3300000062 Bacteria 885
111 JGI24696J40584_12915921 3300002834 Bacteria 1298
112 JGI24696J40584_12920100 3300002834 Bacteria 1339
113 Ga0123356_10345402 3300010049 Bacteria 1610
114 Ga0123356_10404867 3300010049 Bacteria 1503
115 Ga0123356_10482468 3300010049 Bacteria 1393
116 Ga0123356_10826523 3300010049 Bacteria 1098
117 Ga0123356_12716035 3300010049 Bacteria 620
118 Ga0123356_13051378 3300010049 Bacteria 584
119 Ga0123353_11539850 3300010167 Bacteria 844
120 Ga0123353_11697693 3300010167 Bacteria 791
121 Ga0466694_062188 3300042594 Bacteria 2031
122 Ga0466695_021904 3300042595 Bacteria 1485
123 Ga0466712_097577 3300042614 Unclassified 2819
124 Ga0466715_348347 3300042616 Bacteria 3090
125 Ga0466718_048431 3300042617 Bacteria 79612
126 Ga0466718_088096 3300042617 Bacteria 2045
127 Ga0466726_188778 3300042619 Bacteria 1135
128 Ga0466719_333586 3300042606 Bacteria 2725
129 Ga0466703_409619 3300042636 Bacteria 2211
130 Ga0466709_151664 3300042648 Bacteria 8852
131 JGI24698J34947_10041368 3300002449 Unclassified 2374
132 JGI24705J35276_12078546 3300002504 Bacteria 968

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300002462 JGI24702J35022_10052928 JGI24702J35022_100529282 71
2 iso_pr_bacteria 2820731983 2820732693 81
3 3300042592 Ga0466693_073382 Ga0466693_073382_914_1168 84
4 iso_pr_bacteria 644736334 644771720 84
5 2225789004 2227508943 2228001234 85
6 3300002504 JGI24705J35276_12180783 JGI24705J35276_121807831 85
7 3300042594 Ga0466694_319594 Ga0466694_319594_3201_3458 85
8 3300042595 Ga0466695_108738 Ga0466695_108738_3305_3562 85
9 3300042604 Ga0466717_127137 Ga0466717_127137_651_908 85
10 3300042610 Ga0466698_067466 Ga0466698_067466_420_677 85
11 3300042614 Ga0466712_097577 Ga0466712_097577_2528_2785 85
12 2225789004 2227488537 2227957828 86
13 3300000062 IMNBL1DRAFT_c0084134 IMNBL1DRAFT_00841342 86
14 3300002449 JGI24698J34947_10041368 JGI24698J34947_100413682 86
15 3300002449 JGI24698J34947_10194188 JGI24698J34947_101941882 86
16 3300002509 JGI24699J35502_10509164 JGI24699J35502_105091641 86
17 3300002509 JGI24699J35502_11033590 JGI24699J35502_110335902 86
18 3300010049 Ga0123356_13436461 Ga0123356_134364611 86
19 3300010049 Ga0123356_13993909 Ga0123356_139939092 86
20 3300021190 Ga0222431_1034256 Ga0222431_10342562 86
21 3300042593 Ga0466691_033180 Ga0466691_033180_147_407 86
22 3300042594 Ga0466694_062188 Ga0466694_062188_1155_1415 86
23 3300042594 Ga0466694_313269 Ga0466694_313269_533_793 86
24 3300042595 Ga0466695_200795 Ga0466695_200795_33_293 86
25 3300042600 Ga0466700_476101 Ga0466700_476101_577_837 86
26 3300042603 Ga0466714_103198 Ga0466714_103198_768_1028 86
27 3300042603 Ga0466714_164919 Ga0466714_164919_522_782 86
28 3300042608 Ga0466721_276295 Ga0466721_276295_644_904 86
29 3300042609 Ga0466722_089100 Ga0466722_089100_392_652 86
30 3300042609 Ga0466722_260627 Ga0466722_260627_6133_6393 86
31 3300042611 Ga0466697_072413 Ga0466697_072413_748_1008 86
32 3300042614 Ga0466712_033748 Ga0466712_033748_13132_13392 86
33 3300042616 Ga0466715_348347 Ga0466715_348347_1842_2102 86
34 3300042617 Ga0466718_048431 Ga0466718_048431_250_510 86
35 3300042619 Ga0466726_084102 Ga0466726_084102_141_401 86
36 3300042622 Ga0466731_220428 Ga0466731_220428_1535_1795 86
37 3300042635 Ga0466702_132053 Ga0466702_132053_535_795 86
38 iso_pr_bacteria 2820220859 2820222631 86
39 iso_pr_bacteria 2820275298 2820275712 86
40 iso_pr_bacteria 2820414148 2820415796 86
41 iso_pr_bacteria 2820429680 2820431182 86
42 iso_pr_bacteria 2820822094 2820822538 86
43 3300002450 JGI24695J34938_10016776 JGI24695J34938_100167765 87
44 3300002450 JGI24695J34938_10029386 JGI24695J34938_100293863 87
45 3300002450 JGI24695J34938_10376194 JGI24695J34938_103761941 87
46 3300002462 JGI24702J35022_10001399 JGI24702J35022_100013996 87
47 3300002462 JGI24702J35022_10122269 JGI24702J35022_101222693 87
48 3300002504 JGI24705J35276_12078546 JGI24705J35276_120785461 87
49 3300005200 Ga0072940_1416669 Ga0072940_14166693 87
50 3300005201 Ga0072941_1014958 Ga0072941_101495825 87
51 3300009784 Ga0123357_10155621 Ga0123357_101556213 87
52 3300010049 Ga0123356_10010787 Ga0123356_100107873 87
53 3300010049 Ga0123356_10345402 Ga0123356_103454022 87
54 3300010049 Ga0123356_10404867 Ga0123356_104048672 87
55 3300010049 Ga0123356_11129968 Ga0123356_111299682 87
56 3300010049 Ga0123356_11658514 Ga0123356_116585141 87
57 3300010049 Ga0123356_12716035 Ga0123356_127160351 87
58 3300010049 Ga0123356_13051378 Ga0123356_130513781 87
59 3300010167 Ga0123353_10003083 Ga0123353_1000308315 87
60 3300010167 Ga0123353_10006043 Ga0123353_1000604310 87
61 3300010167 Ga0123353_10037459 Ga0123353_100374593 87
62 3300010167 Ga0123353_10065409 Ga0123353_100654093 87
63 3300010167 Ga0123353_10087257 Ga0123353_100872576 87
64 3300010167 Ga0123353_10183189 Ga0123353_101831891 87
65 3300010167 Ga0123353_10344507 Ga0123353_103445073 87
66 3300010167 Ga0123353_10606320 Ga0123353_106063203 87
67 3300010167 Ga0123353_10886582 Ga0123353_108865822 87
68 3300010167 Ga0123353_11306560 Ga0123353_113065603 87
69 3300010167 Ga0123353_11583082 Ga0123353_115830822 87
70 3300010167 Ga0123353_12091972 Ga0123353_120919722 87
71 3300010882 Ga0123354_10118402 Ga0123354_101184026 87
72 3300021244 Ga0223686_1118081 Ga0223686_11180812 87
73 3300038395 Ga0415639_022312 Ga0415639_022312_5864_6127 87
74 3300038395 Ga0415639_103859 Ga0415639_103859_1145_1408 87
75 3300042591 Ga0466692_073922 Ga0466692_073922_273_536 87
76 3300042597 Ga0466699_093995 Ga0466699_093995_1541_1804 87
77 3300042597 Ga0466699_205118 Ga0466699_205118_1912_2175 87
78 3300042597 Ga0466699_221564 Ga0466699_221564_449_712 87
79 3300042603 Ga0466714_097028 Ga0466714_097028_1745_2008 87
80 3300042606 Ga0466719_261172 Ga0466719_261172_1349_1612 87
81 3300042606 Ga0466719_333586 Ga0466719_333586_2366_2629 87
82 3300042617 Ga0466718_088096 Ga0466718_088096_235_498 87
83 3300042619 Ga0466726_188778 Ga0466726_188778_516_779 87
84 3300042619 Ga0466726_345272 Ga0466726_345272_97_360 87
85 3300042620 Ga0466728_267858 Ga0466728_267858_2054_2317 87
86 3300042621 Ga0466729_299856 Ga0466729_299856_1273_1536 87
87 3300042659 Ga0466733_011840 Ga0466733_011840_293_556 87
88 3300042659 Ga0466733_066909 Ga0466733_066909_516_779 87
89 iso_pr_bacteria 2820580397 2820581267 87
90 3300002450 JGI24695J34938_10024523 JGI24695J34938_100245235 88
91 3300002450 JGI24695J34938_10041942 JGI24695J34938_100419423 88
92 3300002462 JGI24702J35022_10012529 JGI24702J35022_100125294 88
93 3300002501 JGI24703J35330_10969415 JGI24703J35330_109694151 88
94 3300002834 JGI24696J40584_12554863 JGI24696J40584_125548632 88
95 3300002834 JGI24696J40584_12915921 JGI24696J40584_129159212 88
96 3300002834 JGI24696J40584_12920100 JGI24696J40584_129201001 88
97 3300009826 Ga0123355_10055384 Ga0123355_100553846 88
98 3300009826 Ga0123355_10128152 Ga0123355_101281522 88
99 3300009826 Ga0123355_10740614 Ga0123355_107406142 88
100 3300009826 Ga0123355_11726632 Ga0123355_117266322 88
101 3300010049 Ga0123356_10023336 Ga0123356_100233364 88
102 3300010049 Ga0123356_10063333 Ga0123356_100633333 88
103 3300010049 Ga0123356_10301635 Ga0123356_103016352 88
104 3300010049 Ga0123356_10482468 Ga0123356_104824681 88
105 3300010049 Ga0123356_10642449 Ga0123356_106424491 88
106 3300010049 Ga0123356_10826523 Ga0123356_108265231 88
107 3300010049 Ga0123356_11254737 Ga0123356_112547372 88
108 3300010049 Ga0123356_11602946 Ga0123356_116029462 88
109 3300010049 Ga0123356_12194152 Ga0123356_121941521 88
110 3300010049 Ga0123356_12477740 Ga0123356_124777402 88
111 3300010167 Ga0123353_10044647 Ga0123353_100446473 88
112 3300010167 Ga0123353_10299071 Ga0123353_102990713 88
113 3300010167 Ga0123353_10432583 Ga0123353_104325833 88
114 3300010167 Ga0123353_10764041 Ga0123353_107640412 88
115 3300010167 Ga0123353_11229276 Ga0123353_112292761 88
116 3300010167 Ga0123353_11479773 Ga0123353_114797732 88
117 3300010167 Ga0123353_11613293 Ga0123353_116132932 88
118 3300010167 Ga0123353_12542129 Ga0123353_125421292 88
119 3300010882 Ga0123354_10444705 Ga0123354_104447052 88
120 3300024493 Ga0264413_126103 Ga0264413_1261032 88
121 3300042599 Ga0466706_237354 Ga0466706_237354_244_510 88
122 3300042616 Ga0466715_151092 Ga0466715_151092_1796_2062 88
123 3300042618 Ga0466723_006565 Ga0466723_006565_120_386 88
124 3300042635 Ga0466702_158998 Ga0466702_158998_304_570 88
125 3300042636 Ga0466703_409619 Ga0466703_409619_848_1114 88
126 3300042648 Ga0466709_151664 Ga0466709_151664_1092_1358 88
127 iso_pr_bacteria 2820267566 2820270638 88
128 3300002462 JGI24702J35022_10611165 JGI24702J35022_106111652 89
129 3300009826 Ga0123355_10001216 Ga0123355_100012161 89
130 3300009826 Ga0123355_10002517 Ga0123355_1000251723 89
131 3300009826 Ga0123355_10102640 Ga0123355_101026405 89
132 3300009826 Ga0123355_10438044 Ga0123355_104380442 89
133 3300010167 Ga0123353_10966809 Ga0123353_109668092 89
134 3300010167 Ga0123353_11697693 Ga0123353_116976932 89
135 3300042595 Ga0466695_021904 Ga0466695_021904_360_629 89
136 3300042623 Ga0466734_163898 Ga0466734_163898_240_509 89
137 3300010049 Ga0123356_10731231 Ga0123356_107312312 90
138 3300010167 Ga0123353_10561858 Ga0123353_105618583 90
139 3300010167 Ga0123353_11539850 Ga0123353_115398502 90
140 3300010167 Ga0123353_13398385 Ga0123353_133983852 90
141 3300010049 Ga0123356_13588489 Ga0123356_135884892 100

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF06769 YoeB_toxin YoeB-like toxin of bacterial type II toxin-antitoxin system 6 84 0.99

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.63 0.78 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.