Protein Family IF02957
Metagenome
Isolate
219
Members
75
Samples
199
Scaffolds
60.79
Avg Length
Representative Sequence
- ID
- 3300010049|Ga0123356_10909872|Ga0123356_109098722
- Length
- 63 aa
- Sequence
- MPNPKRRHSKQRRDKRRTHDSAVIPTVVKCSNCSSSVLYHRVCPSCGYYRGKLAIEKEGAVA*
Sample Types
Isolate
9.1%
Metagenome
90.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
37.8%
Kalotermitidae
18.9%
Unclassified
13.5%
Blattidae
12.2%
Rhinotermitidae
5.4%
Termopsidae
5.4%
Passalidae
2.7%
Hydrophilidae
2.7%
Hodotermitidae
1.4%
Taxonomy
Archaea
0
Bacteria
181
Eukaryota
0
Viruses
0
Unclassified
38
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 2 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 3 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 4 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 5 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 6 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 7 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 8 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 9 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 10 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 11 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 12 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 13 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 14 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 15 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 16 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 17 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 18 | 2820797595 | Unclassified Bacteroidetes Co191P3bin3 | Isolate | Unclassified |
| 19 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 20 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 21 | 2820753519 | Unclassified Bacteroidetes Nc150P4bin20 | Isolate | Unclassified |
| 22 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 23 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 24 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 25 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 26 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 27 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 28 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 29 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 30 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 31 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 32 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 33 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 34 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 35 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 36 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 37 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 38 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 39 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 40 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 41 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 42 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 43 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 44 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 45 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 46 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 47 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 48 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 49 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 50 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 51 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 52 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 53 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 54 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 55 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 56 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 57 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 58 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 59 | 2820792843 | Unclassified Bacteroidetes Cu122P3bin1 | Isolate | Unclassified |
| 60 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 61 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 62 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 63 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 64 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 65 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 66 | 2820795054 | Unclassified Bacteroidetes Cu122P1bin21 | Isolate | Unclassified |
| 67 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 68 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 69 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 70 | 2820755292 | Unclassified Bacteroidetes Nc150P3bin3 | Isolate | Unclassified |
| 71 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 72 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 73 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 74 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 75 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_004941 | 3300042612 | Bacteria | 2822 |
| 2 | Ga0466705_342178 | 3300042612 | Bacteria | 42153 |
| 3 | Ga0466733_006860 | 3300042659 | Bacteria | 2588 |
| 4 | Ga0466733_092757 | 3300042659 | Bacteria | 8349 |
| 5 | Ga0466733_159716 | 3300042659 | Unclassified | 3600 |
| 6 | Ga0123356_10027493 | 3300010049 | Bacteria | 5330 |
| 7 | Ga0123353_10234069 | 3300010167 | Unclassified | 2861 |
| 8 | Ga0123353_10685597 | 3300010167 | Bacteria | 1442 |
| 9 | Ga0123354_10101988 | 3300010882 | Unclassified | 3871 |
| 10 | Ga0123354_10104809 | 3300010882 | Bacteria | 3789 |
| 11 | Ga0123354_10238065 | 3300010882 | Bacteria | 1881 |
| 12 | Ga0466714_001728 | 3300042603 | Bacteria | 35313 |
| 13 | Ga0466719_228278 | 3300042606 | Bacteria | 3349 |
| 14 | Ga0466710_396264 | 3300042613 | Bacteria | 4130 |
| 15 | Ga0466711_223730 | 3300042615 | Unclassified | 4293 |
| 16 | Ga0466735_139015 | 3300042624 | Unclassified | 3230 |
| 17 | Ga0466704_294162 | 3300042643 | Unclassified | 2101 |
| 18 | Ga0466709_240717 | 3300042648 | Bacteria | 4276 |
| 19 | Ga0466657_288391 | 3300042582 | Bacteria | 2387 |
| 20 | Ga0466691_095165 | 3300042593 | Bacteria | 6239 |
| 21 | Ga0466694_093952 | 3300042594 | Bacteria | 1577 |
| 22 | Ga0466695_039550 | 3300042595 | Bacteria | 3924 |
| 23 | 2227566015 | 2225789004 | Bacteria | 2670 |
| 24 | JGI24695J34938_10002757 | 3300002450 | Unclassified | 12910 |
| 25 | JGI24702J35022_10156801 | 3300002462 | Bacteria | 1280 |
| 26 | Ga0068302_10107899 | 3300005071 | Unclassified | 3538 |
| 27 | Ga0068302_10447324 | 3300005071 | Bacteria | 1049 |
| 28 | Ga0072940_1223199 | 3300005200 | Bacteria | 1931 |
| 29 | Ga0072941_1299637 | 3300005201 | Unclassified | 936 |
| 30 | Ga0466705_322943 | 3300042612 | Unclassified | 6310 |
| 31 | Ga0123356_10118770 | 3300010049 | Bacteria | 2568 |
| 32 | Ga0123353_11200078 | 3300010167 | Bacteria | 996 |
| 33 | Ga0466701_022511 | 3300042598 | Bacteria | 4162 |
| 34 | Ga0466706_022851 | 3300042599 | Bacteria | 16146 |
| 35 | Ga0466700_255845 | 3300042600 | Unclassified | 2067 |
| 36 | Ga0466713_037701 | 3300042602 | Bacteria | 30244 |
| 37 | Ga0466719_033141 | 3300042606 | Bacteria | 1361 |
| 38 | Ga0466710_050506 | 3300042613 | Unclassified | 1372 |
| 39 | Ga0466710_143824 | 3300042613 | Bacteria | 11181 |
| 40 | Ga0466711_025258 | 3300042615 | Bacteria | 45468 |
| 41 | Ga0466723_074387 | 3300042618 | Bacteria | 21544 |
| 42 | Ga0466723_240845 | 3300042618 | Bacteria | 2745 |
| 43 | Ga0466735_212860 | 3300042624 | Bacteria | 1437 |
| 44 | Ga0466703_202151 | 3300042636 | Bacteria | 10760 |
| 45 | Ga0466708_396410 | 3300042652 | Bacteria | 17245 |
| 46 | Ga0466727_045002 | 3300042655 | Unclassified | 2065 |
| 47 | Ga0466727_056289 | 3300042655 | Bacteria | 29084 |
| 48 | Ga0466690_264179 | 3300042590 | Bacteria | 3774 |
| 49 | Ga0466693_103770 | 3300042592 | Bacteria | 1458 |
| 50 | Ga0466694_199464 | 3300042594 | Unclassified | 1650 |
| 51 | Ga0466696_451325 | 3300042596 | Bacteria | 7890 |
| 52 | IMNBL1DRAFT_c0001840 | 3300000062 | Bacteria | 15463 |
| 53 | IMNBL1DRAFT_c0146322 | 3300000062 | Bacteria | 608 |
| 54 | Ga0072941_1187559 | 3300005201 | Bacteria | 534 |
| 55 | Ga0466705_034194 | 3300042612 | Bacteria | 7757 |
| 56 | Ga0123356_10486746 | 3300010049 | Bacteria | 1388 |
| 57 | Ga0123353_10061158 | 3300010167 | Unclassified | 6039 |
| 58 | Ga0123353_10498070 | 3300010167 | Bacteria | 1776 |
| 59 | Ga0466706_048730 | 3300042599 | Bacteria | 101759 |
| 60 | Ga0466713_132020 | 3300042602 | Bacteria | 30911 |
| 61 | Ga0466719_057372 | 3300042606 | Bacteria | 1185 |
| 62 | Ga0466721_360199 | 3300042608 | Bacteria | 26778 |
| 63 | Ga0466698_315435 | 3300042610 | Bacteria | 7223 |
| 64 | Ga0466698_426591 | 3300042610 | Unclassified | 2200 |
| 65 | Ga0466705_470782 | 3300042612 | Bacteria | 13035 |
| 66 | Ga0466715_134136 | 3300042616 | Bacteria | 3939 |
| 67 | Ga0466715_544350 | 3300042616 | Bacteria | 12412 |
| 68 | Ga0466718_083554 | 3300042617 | Bacteria | 3634 |
| 69 | Ga0466726_096971 | 3300042619 | Bacteria | 2179 |
| 70 | Ga0466728_152542 | 3300042620 | Unclassified | 1597 |
| 71 | Ga0466735_147677 | 3300042624 | Unclassified | 3101 |
| 72 | Ga0466690_146432 | 3300042590 | Bacteria | 4159 |
| 73 | Ga0466691_179116 | 3300042593 | Bacteria | 10445 |
| 74 | Ga0466694_270538 | 3300042594 | Bacteria | 1544 |
| 75 | Ga0466696_396874 | 3300042596 | Bacteria | 1827 |
| 76 | 2227464603 | 2225789004 | Bacteria | 982 |
| 77 | IMNBL1DRAFT_c0037129 | 3300000062 | Bacteria | 1692 |
| 78 | JGI24702J35022_10004274 | 3300002462 | Bacteria | 8519 |
| 79 | Ga0068305_10069913 | 3300005083 | Bacteria | 6748 |
| 80 | Ga0072941_1210290 | 3300005201 | Bacteria | 1266 |
| 81 | Ga0466705_318819 | 3300042612 | Bacteria | 8925 |
| 82 | Ga0123356_10053433 | 3300010049 | Unclassified | 3760 |
| 83 | Ga0123356_10862341 | 3300010049 | Bacteria | 1077 |
| 84 | Ga0123353_10016092 | 3300010167 | Unclassified | 10911 |
| 85 | Ga0123353_11504243 | 3300010167 | Bacteria | 857 |
| 86 | Ga0123353_12645451 | 3300010167 | Bacteria | 592 |
| 87 | Ga0123354_10173229 | 3300010882 | Unclassified | 2500 |
| 88 | Ga0466706_108763 | 3300042599 | Bacteria | 15518 |
| 89 | Ga0466707_264391 | 3300042601 | Bacteria | 1507 |
| 90 | Ga0466707_286444 | 3300042601 | Bacteria | 9962 |
| 91 | Ga0466713_105312 | 3300042602 | Bacteria | 60870 |
| 92 | Ga0466713_141379 | 3300042602 | Bacteria | 226907 |
| 93 | Ga0466714_090461 | 3300042603 | Bacteria | 2082 |
| 94 | Ga0466716_459747 | 3300042605 | Bacteria | 8036 |
| 95 | Ga0466715_232391 | 3300042616 | Bacteria | 3818 |
| 96 | Ga0466726_179518 | 3300042619 | Bacteria | 7175 |
| 97 | Ga0466726_240570 | 3300042619 | Bacteria | 7507 |
| 98 | Ga0466734_083974 | 3300042623 | Bacteria | 1105 |
| 99 | Ga0466735_076253 | 3300042624 | Bacteria | 2161 |
| 100 | Ga0466730_081443 | 3300042625 | Bacteria | 1030 |
| 101 | Ga0466703_006789 | 3300042636 | Bacteria | 4471 |
| 102 | Ga0466708_064449 | 3300042652 | Unclassified | 1306 |
| 103 | Ga0466708_254328 | 3300042652 | Bacteria | 25412 |
| 104 | Ga0466708_334466 | 3300042652 | Bacteria | 26460 |
| 105 | Ga0466727_050390 | 3300042655 | Bacteria | 11699 |
| 106 | Ga0466692_128376 | 3300042591 | Bacteria | 43265 |
| 107 | Ga0466693_029400 | 3300042592 | Unclassified | 1026 |
| 108 | Ga0466693_135438 | 3300042592 | Bacteria | 2525 |
| 109 | Ga0466691_217743 | 3300042593 | Bacteria | 16754 |
| 110 | Ga0466696_347081 | 3300042596 | Bacteria | 14959 |
| 111 | 2227234973 | 2225789004 | Bacteria | 1355 |
| 112 | IMNBL1DRAFT_c0028202 | 3300000062 | Bacteria | 2098 |
| 113 | JGI24696J40584_12955332 | 3300002834 | Bacteria | 2813 |
| 114 | Ga0123356_10139359 | 3300010049 | Bacteria | 2391 |
| 115 | Ga0123356_10909872 | 3300010049 | Bacteria | 1051 |
| 116 | Ga0123353_10897635 | 3300010167 | Unclassified | 1207 |
| 117 | Ga0466707_104778 | 3300042601 | Bacteria | 1894 |
| 118 | Ga0466722_180718 | 3300042609 | Bacteria | 10903 |
| 119 | Ga0466715_042591 | 3300042616 | Bacteria | 14628 |
| 120 | Ga0466715_087509 | 3300042616 | Bacteria | 4947 |
| 121 | Ga0466715_585069 | 3300042616 | Bacteria | 6298 |
| 122 | Ga0466726_000689 | 3300042619 | Bacteria | 3324 |
| 123 | Ga0466726_040362 | 3300042619 | Unclassified | 1091 |
| 124 | Ga0466735_108380 | 3300042624 | Bacteria | 3390 |
| 125 | Ga0466735_145025 | 3300042624 | Unclassified | 8253 |
| 126 | Ga0466730_080010 | 3300042625 | Bacteria | 1521 |
| 127 | Ga0466703_197762 | 3300042636 | Unclassified | 1645 |
| 128 | Ga0466696_132913 | 3300042596 | Bacteria | 52155 |
| 129 | 2227478256 | 2225789004 | Bacteria | 4545 |
| 130 | IMNBL1DRAFT_c0088199 | 3300000062 | Bacteria | 855 |
| 131 | JGI24695J34938_10621214 | 3300002450 | Bacteria | 505 |
| 132 | JGI24702J35022_10008594 | 3300002462 | Bacteria | 5777 |
| 133 | JGI24702J35022_10199479 | 3300002462 | Bacteria | 1144 |
| 134 | Ga0123357_10000044 | 3300009784 | Bacteria | 100721 |
| 135 | Ga0466697_089493 | 3300042611 | Bacteria | 5838 |
| 136 | Ga0466727_349678 | 3300042655 | Unclassified | 1044 |
| 137 | Ga0466732_368088 | 3300042656 | Bacteria | 6529 |
| 138 | Ga0123353_13017135 | 3300010167 | Bacteria | 545 |
| 139 | Ga0466701_039482 | 3300042598 | Bacteria | 104864 |
| 140 | Ga0466707_061110 | 3300042601 | Bacteria | 2201 |
| 141 | Ga0466707_086343 | 3300042601 | Unclassified | 4690 |
| 142 | Ga0466716_029281 | 3300042605 | Unclassified | 4584 |
| 143 | Ga0466716_166394 | 3300042605 | Unclassified | 1123 |
| 144 | Ga0466716_168812 | 3300042605 | Bacteria | 3215 |
| 145 | Ga0466716_266299 | 3300042605 | Bacteria | 3380 |
| 146 | Ga0466719_134057 | 3300042606 | Bacteria | 8096 |
| 147 | Ga0466719_261143 | 3300042606 | Bacteria | 8679 |
| 148 | Ga0466710_262167 | 3300042613 | Bacteria | 1533 |
| 149 | Ga0466710_405233 | 3300042613 | Bacteria | 1953 |
| 150 | Ga0466735_004889 | 3300042624 | Bacteria | 1524 |
| 151 | Ga0466704_193450 | 3300042643 | Bacteria | 17342 |
| 152 | Ga0466709_340948 | 3300042648 | Bacteria | 51915 |
| 153 | Ga0466709_398108 | 3300042648 | Bacteria | 1114 |
| 154 | Ga0466708_088711 | 3300042652 | Bacteria | 35515 |
| 155 | 2227303006 | 2225789004 | Bacteria | 29397 |
| 156 | IMNBL1DRAFT_c0017754 | 3300000062 | Bacteria | 2980 |
| 157 | IMNBL1DRAFT_c0053890 | 3300000062 | Unclassified | 1250 |
| 158 | IMNBL1DRAFT_c0159376 | 3300000062 | Bacteria | 576 |
| 159 | JGI24705J35276_12236663 | 3300002504 | Bacteria | 8560 |
| 160 | Ga0072941_1636923 | 3300005201 | Bacteria | 1272 |
| 161 | Ga0466697_182716 | 3300042611 | Bacteria | 1171 |
| 162 | Ga0466733_074569 | 3300042659 | Bacteria | 12665 |
| 163 | Ga0123357_10464674 | 3300009784 | Unclassified | 1084 |
| 164 | Ga0123356_11290158 | 3300010049 | Bacteria | 894 |
| 165 | Ga0466707_420035 | 3300042601 | Bacteria | 14009 |
| 166 | Ga0466716_356608 | 3300042605 | Bacteria | 21145 |
| 167 | Ga0466715_385280 | 3300042616 | Bacteria | 24407 |
| 168 | Ga0466728_133449 | 3300042620 | Bacteria | 2932 |
| 169 | Ga0466728_390946 | 3300042620 | Bacteria | 4191 |
| 170 | Ga0466735_098429 | 3300042624 | Unclassified | 6174 |
| 171 | Ga0466735_126954 | 3300042624 | Bacteria | 4521 |
| 172 | Ga0466730_089850 | 3300042625 | Unclassified | 1167 |
| 173 | Ga0466709_133538 | 3300042648 | Bacteria | 9074 |
| 174 | Ga0466709_253893 | 3300042648 | Unclassified | 4282 |
| 175 | Ga0466656_371873 | 3300042550 | Bacteria | 1545 |
| 176 | Ga0466692_090361 | 3300042591 | Bacteria | 3200 |
| 177 | Ga0466696_082686 | 3300042596 | Bacteria | 2569 |
| 178 | IMNBL1DRAFT_c0039991 | 3300000062 | Bacteria | 1592 |
| 179 | JGI24702J35022_10001519 | 3300002462 | Bacteria | 14409 |
| 180 | Ga0466733_136322 | 3300042659 | Bacteria | 3351 |
| 181 | Ga0123357_10156287 | 3300009784 | Bacteria | 2749 |
| 182 | Ga0123356_10175863 | 3300010049 | Unclassified | 2157 |
| 183 | Ga0466700_056523 | 3300042600 | Bacteria | 3932 |
| 184 | Ga0466713_120509 | 3300042602 | Bacteria | 47742 |
| 185 | Ga0466717_101219 | 3300042604 | Bacteria | 2675 |
| 186 | Ga0466698_053535 | 3300042610 | Bacteria | 1123 |
| 187 | Ga0466698_411117 | 3300042610 | Bacteria | 2054 |
| 188 | Ga0466710_267627 | 3300042613 | Bacteria | 1638 |
| 189 | Ga0466712_029102 | 3300042614 | Bacteria | 2721 |
| 190 | Ga0466711_027006 | 3300042615 | Bacteria | 33406 |
| 191 | Ga0466715_284476 | 3300042616 | Bacteria | 35153 |
| 192 | Ga0466726_168827 | 3300042619 | Bacteria | 10185 |
| 193 | Ga0466728_302977 | 3300042620 | Bacteria | 25242 |
| 194 | Ga0466735_141602 | 3300042624 | Unclassified | 6646 |
| 195 | Ga0466657_063134 | 3300042582 | Bacteria | 3479 |
| 196 | Ga0466690_065709 | 3300042590 | Bacteria | 9325 |
| 197 | Ga0466694_003823 | 3300042594 | Bacteria | 3788 |
| 198 | Ga0466696_145313 | 3300042596 | Bacteria | 2850 |
| 199 | JGI24702J35022_10084234 | 3300002462 | Bacteria | 1725 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01783 | Ribosomal_L32p | Ribosomal L32p protein family | 3 | 56 | 0.96 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.