Protein Family IF02954

Metagenome Metatranscriptome Isolate
214 Members
122 Samples
156 Scaffolds
137.58 Avg Length

🧬 Representative Sequence

ID
3300010049|Ga0123356_10839719|Ga0123356_108397193
Length
140 aa
Sequence
MSMLQPKRTKYRKQFKGRNAGLAHRGSDVSFGDFGLKATSRARMTAREIEAARRAMARYVKRGGQIWIRVFPDVPISKKPLEVRMGSGKGNVEYYVARVQPGKVLFEMEGVDETTAREAFRLAGSKLSVSTTFVKRQVR*

📊 Sample Types

Isolate 27.1%
Metagenome 72.4%
MAG 0.0%
Metatranscriptome 0.5%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 21.4%
Apidae 16.2%
Unclassified 15.4%
Kalotermitidae 11.1%
Elmidae 8.5%
Aleyrodidae 4.3%
Armadillidiidae 3.4%
Culicidae 3.4%
Drosophilidae 2.6%
Ixodidae 2.6%
Termopsidae 1.7%
Curculionidae 1.7%
Pediculidae 0.9%
Passalidae 0.9%
Daphniidae 0.9%
Rhinotermitidae 0.9%
Hodotermitidae 0.9%
Formicidae 0.9%
Tenebrionidae 0.9%
Cerambycidae 0.9%
Noctuidae 0.9%

🌳 Taxonomy

Archaea 0
Bacteria 198
Eukaryota 0
Viruses 0
Unclassified 16

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2864863795 Acinetobacter johnsonii S00116 Isolate Elmidae
2 2751185856 Bartonella apis BBC0244 Isolate Apidae
3 2820097052 Unclassified Proteobacteria Lab288P3bin109 Isolate Unclassified
4 2820098966 Unclassified Proteobacteria Lab288P1bin49 Isolate Unclassified
5 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
6 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
7 3003178663 Psychrobacter fulvigenes KC-40 Isolate Unclassified
8 3006156446 Acinetobacter baretiae B10A Isolate Apidae
9 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
10 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
11 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
12 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
13 8073617375 Bartonella apis W8098 Isolate Apidae
14 8082291289 Bartonella apihabitans K-FP28 Isolate Apidae
15 2841821538 Psychrobacter sp. YP14 Isolate Unclassified
16 2864843793 Acinetobacter johnsonii S00075 Isolate Elmidae
17 2873468275 Agrobacterium vitis S00131 Isolate Elmidae
18 2821312900 Unclassified Proteobacteria Lab288P4bin16 Isolate Unclassified
19 2820096063 Unclassified Proteobacteria Lab288P3bin136 Isolate Unclassified
20 2820097968 Unclassified Proteobacteria Lab288P3bin104 Isolate Unclassified
21 2512047025 Candidatus Portiera aleyrodidarum Isolate Aleyrodidae
22 2518645538 Candidatus Portiera aleyrodidarum BT-QVLC Isolate Aleyrodidae
23 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
24 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
25 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
26 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
27 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
28 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
29 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
30 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
31 641522603 Acinetobacter baumannii SDF Isolate Pediculidae
32 8073624232 Bartonella sp. W8151 Isolate Apidae
33 2864874997 Acinetobacter lwoffii S00127 Isolate Elmidae
34 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
35 2619619079 Sphingomonas sp. Mn802worker Isolate Termitidae
36 2751185853 Bartonella apis BBC0178 Isolate Apidae
37 2820067954 Unclassified Proteobacteria Nt197P3bin44 Isolate Unclassified
38 2820141685 Unclassified Proteobacteria Emb289P3bin118 Isolate Unclassified
39 2820151121 Unclassified Proteobacteria Cu122P5bin52 Isolate Unclassified
40 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
41 3300012806 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG Metagenome
42 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
43 8068944069 Bartonella choladocola W8125 Isolate Apidae
44 8068955631 Bartonella apihabitans M0280 Isolate Apidae
45 8073628750 Bartonella sp. W8167 Isolate Apidae
46 2864840607 Acinetobacter johnsonii S00071 Isolate Elmidae
47 2864955722 Sphingomonas kyeonggiensis S00224 Isolate Elmidae
48 2751185858 Bartonella apis BBC0122 Isolate Apidae
49 2517093038 Candidatus Portiera aleyrodidarum BT-B Isolate Aleyrodidae
50 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
51 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
52 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
53 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
54 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
55 3300007150 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut Metagenome Drosophilidae
56 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Drosophilidae
57 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
58 8068941587 Bartonella choladocola B10834H15 Isolate Apidae
59 8073619611 Bartonella apis B10834G6 Isolate Apidae
60 2828301124 Sphingomonas leidyi DSM 4733 Isolate Unclassified
61 2556921669 Shinella sp. DD12 Isolate Daphniidae
62 2820074476 Unclassified Proteobacteria Nt197P3bin125 Isolate Unclassified
63 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
64 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
65 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
66 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
67 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
68 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
69 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
70 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
71 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
72 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
73 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
74 3300021222 Termite gut microbial communities from nest from French Guiana - FG16_17b_4 mRNA SA Metatranscriptome
75 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
76 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
77 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
78 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
79 8021899934 Acinetobacter sp. AR2-3 Isolate Culicidae
80 8068946563 Bartonella apihabitans M0187 Isolate Apidae
81 650716015 Candidatus Midichloria mitochondrii IricVA Isolate Ixodidae
82 2864804954 Acinetobacter johnsonii S00050 Isolate Elmidae
83 2864973726 Acinetobacter schindleri S00243 Isolate Elmidae
84 2864976888 Novosphingobium chloroacetimidivorans S00245 Isolate Elmidae
85 2084038013 Anoplophora glabripennis gut microbial communities from Worchester, Massachusetts, USA - Larvae Metagenome Cerambycidae
86 2515154046 Candidatus Portiera aleyrodidarum Isolate Aleyrodidae
87 2518285589 Candidatus Portiera aleyrodidarum TV (unscreened) Isolate Aleyrodidae
88 2599185121 Rickettsiales bacterium Ac37b Isolate Ixodidae
89 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
90 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
91 3002773460 Coxiella endosymbiont of Amblyomma nuttalli Craf2019 Isolate Ixodidae
92 3006190525 Acinetobacter sp. S54 Isolate Curculionidae
93 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
94 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
95 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
96 8068953321 Bartonella apihabitans M0190 Isolate Apidae
97 2724678956 Methylobacterium sp. GXS13 Isolate Unclassified
98 2820136564 Unclassified Proteobacteria Emb289P3bin18 Isolate Unclassified
99 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
100 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
101 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
102 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
103 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
104 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
105 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
106 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
107 8073626464 Bartonella apis W8152 Isolate Apidae
108 2841330038 Sulfitobacter sp. D7 Isolate
109 2864993140 Agrobacterium vitis S00303 Isolate Elmidae
110 2531839311 Acinetobacter sp. HA Isolate Noctuidae
111 2820052737 Unclassified Proteobacteria Th196P3bin127 Isolate Unclassified
112 2820064859 Unclassified Proteobacteria Nt197P3bin78 Isolate Unclassified
113 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
114 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
115 3300012820 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG Metagenome Armadillidiidae
116 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
117 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
118 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
119 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
120 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
121 8068950955 Bartonella apihabitans W8097 Isolate Apidae
122 8073621894 Bartonella apis W8099 Isolate Apidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_085490 3300042612 Bacteria 16826
2 Ga0466710_018429 3300042613 Bacteria 3018
3 Ga0466712_083549 3300042614 Bacteria 35151
4 Ga0466711_320332 3300042615 Bacteria 16097
5 Ga0160456_100001 3300012820 Bacteria 1115787
6 Ga0160443_100092 3300012848 Bacteria 156141
7 Ga0415639_042719 3300038395 Bacteria 8960
8 Ga0415639_195959 3300038395 Bacteria 4162
9 Ga0466657_233955 3300042582 Bacteria 3104
10 Ga0466690_149599 3300042590 Bacteria 2616
11 Ga0466690_424028 3300042590 Bacteria 1866
12 Ga0466692_004664 3300042591 Bacteria 2637
13 Ga0466730_059466 3300042625 Bacteria 59728
14 Ga0466703_340680 3300042636 Unclassified 1328
15 Ga0466709_066803 3300042648 Bacteria 19205
16 Ga0466708_274813 3300042652 Bacteria 19172
17 Ga0466713_154705 3300042602 Bacteria 6020
18 Ga0466714_020817 3300042603 Bacteria 1929
19 Ga0466714_142619 3300042603 Bacteria 1455
20 JGI24705J35276_11898656 3300002504 Unclassified 750
21 Ga0466733_109908 3300042659 Unclassified 2121
22 Ga0466733_144713 3300042659 Bacteria 6687
23 Ga0466711_485360 3300042615 Bacteria 6488
24 Ga0466723_037812 3300042618 Bacteria 8832
25 Ga0466728_012515 3300042620 Bacteria 24746
26 Ga0264413_105507 3300024493 Bacteria 126830
27 Ga0466691_153507 3300042593 Bacteria 4198
28 Ga0466694_132544 3300042594 Bacteria 33504
29 Ga0466703_118770 3300042636 Bacteria 3393
30 Ga0466703_238221 3300042636 Bacteria 1370
31 Ga0466703_416530 3300042636 Bacteria 1958
32 Ga0466704_525120 3300042643 Bacteria 8699
33 Ga0466706_069356 3300042599 Bacteria 23054
34 Ga0466714_030368 3300042603 Bacteria 5333
35 Ga0466714_058882 3300042603 Bacteria 5438
36 Ga0466714_145539 3300042603 Unclassified 2473
37 Ga0466719_206452 3300042606 Bacteria 3453
38 Ga0123355_10653871 3300009826 Unclassified 1225
39 Ga0123356_10791406 3300010049 Bacteria 1119
40 Ga0072940_1456377 3300005200 Bacteria 1334
41 Ga0104019_1031872 3300007150 Bacteria 1536
42 Ga0466705_301731 3300042612 Bacteria 5712
43 Ga0466705_309138 3300042612 Bacteria 9773
44 Ga0466705_417056 3300042612 Bacteria 108359
45 Ga0466711_265954 3300042615 Unclassified 2147
46 Ga0466711_498210 3300042615 Bacteria 1687
47 Ga0160460_100431 3300012845 Bacteria 25502
48 Ga0466690_321146 3300042590 Bacteria 1336
49 Ga0466691_022899 3300042593 Bacteria 27358
50 Ga0466730_101888 3300042625 Unclassified 1031
51 Ga0466703_295770 3300042636 Bacteria 1483
52 Ga0466704_360008 3300042643 Bacteria 4388
53 Ga0466704_402603 3300042643 Unclassified 1730
54 Ga0466708_205006 3300042652 Unclassified 2370
55 Ga0466706_196969 3300042599 Bacteria 4356
56 Ga0123355_10046347 3300009826 Bacteria 7070
57 Ga0123356_10028387 3300010049 Bacteria 5242
58 Ga0123356_10839719 3300010049 Bacteria 1090
59 Ga0123356_11203887 3300010049 Bacteria 923
60 AglaG_contig15468 2084038013 Bacteria 3253
61 Ga0074278_136676 3300005721 Bacteria 12904
62 Ga0466728_425492 3300042620 Bacteria 7783
63 Ga0160472_118556 3300012839 Bacteria 702
64 Ga0466690_209809 3300042590 Unclassified 1204
65 Ga0466699_194057 3300042597 Bacteria 1366
66 Ga0466701_001716 3300042598 Bacteria 6090
67 Ga0466735_197452 3300042624 Unclassified 1003
68 Ga0466703_177176 3300042636 Bacteria 5150
69 Ga0466703_215659 3300042636 Bacteria 5096
70 Ga0466703_301560 3300042636 Bacteria 10414
71 Ga0466725_167598 3300042654 Bacteria 15022
72 Ga0466714_074198 3300042603 Bacteria 829090
73 Ga0466716_229015 3300042605 Bacteria 8253
74 Ga0123355_10443988 3300009826 Bacteria 1640
75 Ga0123356_10000008 3300010049 Bacteria 237851
76 Ga0123353_10791780 3300010167 Bacteria 1311
77 Ga0160442_101440 3300012806 Bacteria 2884
78 Ga0104045_1078904 3300007085 Bacteria 1344
79 Ga0466705_311791 3300042612 Bacteria 46136
80 Ga0530661_074356 3300056564 Bacteria 984
81 Ga0466723_154869 3300042618 Bacteria 18650
82 Ga0466728_290658 3300042620 Bacteria 41498
83 Ga0160433_100390 3300012846 Bacteria 24521
84 Ga0223678_1012114 3300021222 Bacteria 1060
85 Ga0466690_283797 3300042590 Unclassified 10434
86 Ga0466691_111565 3300042593 Bacteria 13632
87 Ga0466696_270618 3300042596 Bacteria 1898
88 Ga0466699_084654 3300042597 Bacteria 126395
89 Ga0466700_061306 3300042600 Bacteria 1314
90 Ga0466707_193507 3300042601 Bacteria 1330
91 Ga0466719_436555 3300042606 Bacteria 1537
92 Ga0466719_507146 3300042606 Unclassified 1235
93 Ga0123355_10702703 3300009826 Unclassified 1160
94 Ga0123355_11243646 3300009826 Bacteria 754
95 Ga0103267_1000321 3300007190 Bacteria 18863
96 Ga0466705_358854 3300042612 Bacteria 4724
97 Ga0530661_000258 3300056564 Bacteria 42354
98 Ga0466710_017395 3300042613 Bacteria 26782
99 Ga0466710_336423 3300042613 Bacteria 1390
100 Ga0466723_317290 3300042618 Bacteria 1209
101 Ga0466728_277405 3300042620 Bacteria 3464
102 Ga0264413_151886 3300024493 Bacteria 1351
103 Ga0466690_321216 3300042590 Bacteria 7849
104 Ga0466693_113441 3300042592 Bacteria 28543
105 Ga0466703_172966 3300042636 Bacteria 10779
106 Ga0466703_276280 3300042636 Bacteria 1136
107 Ga0466704_025574 3300042643 Bacteria 55023
108 Ga0466706_054789 3300042599 Bacteria 17954
109 Ga0466716_371910 3300042605 Bacteria 8374
110 Ga0466719_498852 3300042606 Bacteria 39193
111 Ga0123356_10001668 3300010049 Bacteria 24294
112 Ga0123356_12219459 3300010049 Bacteria 686
113 Ga0123353_10040063 3300010167 Bacteria 7386
114 Ga0123353_10235214 3300010167 Unclassified 2852
115 AustNasuHG_c1075980 3300000089 Bacteria 585
116 Ga0105005_1033507 3300007505 Bacteria 5802
117 Ga0466705_221739 3300042612 Bacteria 2054
118 Ga0160468_100004 3300012819 Bacteria 631412
119 Ga0160430_117358 3300012852 Bacteria 1049
120 Ga0160436_1002610 3300012861 Bacteria 4533
121 Ga0466691_074179 3300042593 Bacteria 55711
122 Ga0466696_286610 3300042596 Bacteria 1222
123 Ga0466703_134989 3300042636 Bacteria 8257
124 Ga0466704_404182 3300042643 Bacteria 7663
125 Ga0466704_560178 3300042643 Bacteria 28918
126 Ga0466708_056854 3300042652 Bacteria 2360
127 Ga0466706_108999 3300042599 Bacteria 1318
128 Ga0123355_10069890 3300009826 Bacteria 5642
129 Ga0123354_10001685 3300010882 Bacteria 27609
130 2227488217 2225789004 Bacteria 805
131 JGI24698J34947_10135924 3300002449 Bacteria 1043
132 Ga0466718_027476 3300042617 Bacteria 128381
133 Ga0466726_168909 3300042619 Bacteria 20510
134 Ga0466657_144931 3300042582 Bacteria 5126
135 Ga0466696_312122 3300042596 Bacteria 7170
136 Ga0466734_027518 3300042623 Bacteria 13115
137 Ga0466730_062117 3300042625 Bacteria 5191
138 Ga0466703_079639 3300042636 Bacteria 72500
139 Ga0466703_152711 3300042636 Bacteria 41109
140 Ga0466703_191918 3300042636 Bacteria 1027
141 Ga0466703_204168 3300042636 Bacteria 39826
142 Ga0466703_364880 3300042636 Bacteria 1812
143 Ga0466709_172994 3300042648 Bacteria 28560
144 Ga0466706_083722 3300042599 Bacteria 7162
145 Ga0466706_117179 3300042599 Bacteria 17599
146 Ga0466707_017686 3300042601 Bacteria 186599
147 Ga0466716_429562 3300042605 Bacteria 29095
148 Ga0123357_10015501 3300009784 Bacteria 9995
149 Ga0123356_13039993 3300010049 Bacteria 585
150 Ga0123353_10000018 3300010167 Bacteria 185150
151 Ga0123353_10000047 3300010167 Bacteria 134029
152 Ga0123353_10000370 3300010167 Bacteria 55114
153 Ga0123353_10262802 3300010167 Bacteria 2664
154 Ga0123353_10660196 3300010167 Bacteria 1478
155 HBC_ctgsDRAFT_1052040 3300000333 Unclassified 994
156 Ga0063521_1005379 3300003973 Bacteria 3028

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00252 Ribosomal_L16 Ribosomal protein L16p/L10e 6 134 0.98

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.