Protein Family IF02948
Metagenome
Isolate
149
Members
83
Samples
91
Scaffolds
235.12
Avg Length
Representative Sequence
- ID
- 3300010049|Ga0123356_10728759|Ga0123356_107287592
- Length
- 265 aa
- Sequence
- MRPRHYHIQRSREQGAEDEGFIAMTAVNNTNVLKKMPAAFRAAFPYTIPVLAGFLFLGMAYGILMSARGYGWPWVLLTSAVVFAGALQFVGISLLTSVFDPIYAFLIALAVNARHLFYGISMLEKYNGTGAIKPYLIFGMCDETFSILCSTPPPPGVDRRAFMLALTLLNQSFWVLGSVAGGLVGPLLTFDTHGIDFVMTAFFIVIFINQWRATKSHSPALIGVGAAAVSLIVFGAEGFIIPSMILIVIVLTVFRGKLAKGVDD*
Sample Types
Isolate
38.9%
Metagenome
61.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
33.7%
Termitidae
20.5%
Blattidae
19.3%
Apidae
14.5%
Kalotermitidae
4.8%
Passalidae
3.6%
Hodotermitidae
1.2%
Formicidae
1.2%
Tenebrionidae
1.2%
Taxonomy
Archaea
0
Bacteria
137
Eukaryota
0
Viruses
1
Unclassified
11
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940264388 | Lachnospiraceae bacterium PFB1-17 | Isolate | Blattidae |
| 2 | 2940267548 | Lachnospiraceae bacterium PFB1-22 | Isolate | Blattidae |
| 3 | 2940280053 | Lachnospiraceae bacterium PF1-22 | Isolate | Blattidae |
| 4 | 2944625312 | Dysgonomonas sp. PF1-3 | Isolate | Blattidae |
| 5 | 2585428085 | Sporobacter termitidis DSM 10068 | Isolate | Termitidae |
| 6 | 2597490194 | Bifidobacterium coryneforme LMG 18911 | Isolate | Apidae |
| 7 | 2671180601 | Bifidobacterium asteroides DSM 20089 | Isolate | Unclassified |
| 8 | 2820227065 | Unclassified Firmicutes Th196P4bin44 | Isolate | Unclassified |
| 9 | 2820620956 | Unclassified Firmicutes Emb289P1bin128 | Isolate | Unclassified |
| 10 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 11 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 12 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 13 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 14 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 15 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 16 | 8110341875 | Bifidobacterium polysaccharolyticum W8117 | Isolate | Apidae |
| 17 | 2940228231 | Anaerovoracaceae bacterium PM5-7 | Isolate | Blattidae |
| 18 | 2940286528 | Lachnospiraceae bacterium PFB1-21 | Isolate | Blattidae |
| 19 | 2808606957 | Bifidobacterium sp. ESL0447 | Isolate | Unclassified |
| 20 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 21 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 22 | 2890957088 | Psychrobacillus lasiicapitis NEAU-3TGS17 | Isolate | Formicidae |
| 23 | 2940277027 | Lachnospiraceae bacterium PF1-21 | Isolate | Blattidae |
| 24 | 2940373808 | Fusobacterium sp. PH5-7 | Isolate | Blattidae |
| 25 | 8024981139 | Bifidobacterium asteroides ESL0170 | Isolate | Apidae |
| 26 | 8024984606 | Bifidobacterium asteroides ESL0199 | Isolate | Apidae |
| 27 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 28 | 2684622918 | Bifidobacterium asteroides Bi_198 | Isolate | Unclassified |
| 29 | 2820267566 | Unclassified Firmicutes Th196P3bin33 | Isolate | Unclassified |
| 30 | 2820525019 | Unclassified Firmicutes Lab288P1bin2 | Isolate | Unclassified |
| 31 | 2820630457 | Unclassified Firmicutes Emb289P1bin119 | Isolate | Unclassified |
| 32 | 2820637417 | Unclassified Firmicutes Emb289P1bin108 | Isolate | Unclassified |
| 33 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 34 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 35 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 36 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 37 | 8110340172 | Bifidobacterium choladohabitans B14384H11 | Isolate | Apidae |
| 38 | 2940292506 | Lachnoclostridium sp. PH5-23 | Isolate | Blattidae |
| 39 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 40 | 2519899775 | Bifidobacterium asteroides PRL2011 | Isolate | Apidae |
| 41 | 2529293168 | Ruminiclostridium cellobioparum termitidis CT1112 | Isolate | Termitidae |
| 42 | 2820238527 | Unclassified Firmicutes Th196P3bin90 | Isolate | Unclassified |
| 43 | 2820594669 | Unclassified Firmicutes Emb289P1bin61 | Isolate | Unclassified |
| 44 | 2820606014 | Unclassified Firmicutes Emb289P1bin49 | Isolate | Unclassified |
| 45 | 2820685979 | Unclassified Firmicutes Co191P1bin81 | Isolate | Unclassified |
| 46 | 2879643867 | Bifidobacterium sp. wkB344 | Isolate | Apidae |
| 47 | 2940270707 | Lachnoclostridium sp. PF1-13 | Isolate | Blattidae |
| 48 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 49 | 2684622920 | Bifidobacterium asteroides Bi_200 | Isolate | Unclassified |
| 50 | 2802429577 | Bifidobacterium indicum DSM 20214 | Isolate | Unclassified |
| 51 | 2820378768 | Unclassified Firmicutes Nt197P1bin7 | Isolate | Unclassified |
| 52 | 2820483401 | Unclassified Firmicutes Lab288P1bin74 | Isolate | Unclassified |
| 53 | 2940233634 | Lachnoclostridium sp. PF5-10 | Isolate | Blattidae |
| 54 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 55 | 8024982947 | Bifidobacterium asteroides ESL0200 | Isolate | Apidae |
| 56 | 2660238275 | Bifidobacterium indicum DSM 20214 | Isolate | Unclassified |
| 57 | 2684622916 | Bifidobacterium asteroides Bi_170 | Isolate | Unclassified |
| 58 | 2684622917 | Bifidobacterium coryneforme Bi_197 | Isolate | Unclassified |
| 59 | 2693429521 | Bifidobacterium coryneforme DSM 20216 | Isolate | Unclassified |
| 60 | 2820356982 | Unclassified Firmicutes Nt197P3bin19 | Isolate | Unclassified |
| 61 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 62 | 2940230426 | Lachnospiraceae bacterium PH5-48 | Isolate | Blattidae |
| 63 | 2940283334 | Lachnospiraceae bacterium PF1-4 | Isolate | Blattidae |
| 64 | 2940295490 | Lachnospiraceae bacterium PH1-22 | Isolate | Blattidae |
| 65 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 66 | 2513237174 | Bifidobacterium asteroides ATCC 25910 | Isolate | Apidae |
| 67 | 2820353569 | Unclassified Firmicutes Nt197P3bin28 | Isolate | Unclassified |
| 68 | 2820385248 | Unclassified Firmicutes Nt197P1bin19 | Isolate | Unclassified |
| 69 | 2820516196 | Unclassified Firmicutes Lab288P1bin3 | Isolate | Unclassified |
| 70 | 2820673891 | Unclassified Firmicutes Co191P3bin18 | Isolate | Unclassified |
| 71 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 72 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 73 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 74 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 75 | 2940273867 | Lachnoclostridium sp. PH1-16 | Isolate | Blattidae |
| 76 | 2940289514 | Lachnospiraceae bacterium PM6-15 | Isolate | Blattidae |
| 77 | 8024986378 | Bifidobacterium asteroides ESL0198 | Isolate | Apidae |
| 78 | 8032009961 | Bifidobacterium indicum ESL0197 | Isolate | Apidae |
| 79 | 2568526170 | Bifidobacterium sp. A11 | Isolate | Apidae |
| 80 | 2684622919 | Bifidobacterium asteroides Bi_199 | Isolate | Unclassified |
| 81 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 82 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 83 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_154026 | 3300042611 | Bacteria | 2379 |
| 2 | Ga0466705_276101 | 3300042612 | Bacteria | 20226 |
| 3 | Ga0123355_10000634 | 3300009826 | Bacteria | 47532 |
| 4 | Ga0123355_10005705 | 3300009826 | Bacteria | 18294 |
| 5 | Ga0123355_10035149 | 3300009826 | Unclassified | 8146 |
| 6 | Ga0123355_10073821 | 3300009826 | Bacteria | 5465 |
| 7 | Ga0123356_10165091 | 3300010049 | Bacteria | 2217 |
| 8 | Ga0123353_10194354 | 3300010167 | Bacteria | 3199 |
| 9 | Ga0123354_10419287 | 3300010882 | Unclassified | 1114 |
| 10 | Ga0466714_031987 | 3300042603 | Bacteria | 4677 |
| 11 | Ga0123355_10006926 | 3300009826 | Bacteria | 16876 |
| 12 | Ga0123355_10032027 | 3300009826 | Bacteria | 8533 |
| 13 | Ga0123355_10138239 | 3300009826 | Unclassified | 3737 |
| 14 | Ga0123355_10251942 | 3300009826 | Bacteria | 2484 |
| 15 | Ga0123355_10621475 | 3300009826 | Bacteria | 1273 |
| 16 | Ga0123353_10092729 | 3300010167 | Bacteria | 4865 |
| 17 | Ga0123353_10212658 | 3300010167 | Bacteria | 3032 |
| 18 | Ga0123353_10265352 | 3300010167 | Bacteria | 2649 |
| 19 | Ga0466693_320273 | 3300042592 | Bacteria | 1158 |
| 20 | Ga0466706_017558 | 3300042599 | Bacteria | 1260 |
| 21 | Ga0466707_073145 | 3300042601 | Bacteria | 1714 |
| 22 | Ga0466714_169474 | 3300042603 | Viruses | 1954 |
| 23 | Ga0466719_224589 | 3300042606 | Bacteria | 1601 |
| 24 | IMNBL1DRAFT_c0000102 | 3300000062 | Bacteria | 74795 |
| 25 | JGI24702J35022_10006302 | 3300002462 | Bacteria | 6867 |
| 26 | Ga0562377_0006 | 3300056842 | Bacteria | 3350072 |
| 27 | Ga0123355_10009180 | 3300009826 | Bacteria | 15005 |
| 28 | Ga0123355_10317221 | 3300009826 | Bacteria | 2105 |
| 29 | Ga0123355_10337498 | 3300009826 | Bacteria | 2011 |
| 30 | Ga0123355_10441564 | 3300009826 | Bacteria | 1647 |
| 31 | Ga0123356_10043562 | 3300010049 | Bacteria | 4179 |
| 32 | Ga0123353_10316197 | 3300010167 | Bacteria | 2372 |
| 33 | Ga0415639_098324 | 3300038395 | Bacteria | 4816 |
| 34 | Ga0415639_210888 | 3300038395 | Unclassified | 1930 |
| 35 | Ga0466691_050987 | 3300042593 | Bacteria | 6420 |
| 36 | Ga0466700_304336 | 3300042600 | Bacteria | 1834 |
| 37 | IMNBL1DRAFT_c0000456 | 3300000062 | Bacteria | 34185 |
| 38 | IMNBL1DRAFT_c0001447 | 3300000062 | Unclassified | 17753 |
| 39 | Ga0466733_166766 | 3300042659 | Bacteria | 1333 |
| 40 | Ga0123355_10754049 | 3300009826 | Bacteria | 1100 |
| 41 | Ga0123356_10728759 | 3300010049 | Bacteria | 1161 |
| 42 | Ga0123353_10201129 | 3300010167 | Bacteria | 3134 |
| 43 | Ga0123353_10538693 | 3300010167 | Bacteria | 1688 |
| 44 | Ga0123353_11754477 | 3300010167 | Unclassified | 774 |
| 45 | Ga0123354_10103189 | 3300010882 | Bacteria | 3837 |
| 46 | Ga0466693_026359 | 3300042592 | Bacteria | 1687 |
| 47 | Ga0466714_014946 | 3300042603 | Bacteria | 2500 |
| 48 | JGI24695J34938_10000150 | 3300002450 | Bacteria | 63664 |
| 49 | Ga0072940_1075034 | 3300005200 | Bacteria | 1388 |
| 50 | Ga0466703_254170 | 3300042636 | Bacteria | 1996 |
| 51 | Ga0123356_10196334 | 3300010049 | Bacteria | 2054 |
| 52 | Ga0466694_193125 | 3300042594 | Bacteria | 5812 |
| 53 | Ga0466706_067539 | 3300042599 | Bacteria | 2774 |
| 54 | Ga0466714_036317 | 3300042603 | Bacteria | 1350 |
| 55 | Ga0466714_143689 | 3300042603 | Bacteria | 1940 |
| 56 | 2227049802 | 2225789003 | Bacteria | 3968 |
| 57 | 2227495743 | 2225789004 | Unclassified | 3945 |
| 58 | IMNBL1DRAFT_c0016082 | 3300000062 | Bacteria | 3218 |
| 59 | Ga0123355_10003986 | 3300009826 | Bacteria | 21373 |
| 60 | Ga0123355_10018469 | 3300009826 | Bacteria | 11063 |
| 61 | Ga0123355_10039897 | 3300009826 | Unclassified | 7643 |
| 62 | Ga0123355_10096745 | 3300009826 | Bacteria | 4662 |
| 63 | Ga0123355_10228058 | 3300009826 | Bacteria | 2665 |
| 64 | Ga0123355_10706854 | 3300009826 | Bacteria | 1155 |
| 65 | Ga0123353_10460742 | 3300010167 | Bacteria | 1868 |
| 66 | Ga0123353_11089876 | 3300010167 | Bacteria | 1062 |
| 67 | Ga0415639_163831 | 3300038395 | Bacteria | 1502 |
| 68 | Ga0466694_123750 | 3300042594 | Bacteria | 4048 |
| 69 | Ga0466714_076883 | 3300042603 | Bacteria | 2318 |
| 70 | Ga0466714_090645 | 3300042603 | Bacteria | 1041 |
| 71 | 2227191909 | 2225789004 | Bacteria | 34126 |
| 72 | IMNBL1DRAFT_c0000042 | 3300000062 | Bacteria | 116840 |
| 73 | JGI24703J35330_11732381 | 3300002501 | Unclassified | 2792 |
| 74 | Ga0123355_10001470 | 3300009826 | Bacteria | 32778 |
| 75 | Ga0123356_10520196 | 3300010049 | Bacteria | 1348 |
| 76 | Ga0123353_10376674 | 3300010167 | Bacteria | 2125 |
| 77 | Ga0123354_10327946 | 3300010882 | Unclassified | 1401 |
| 78 | Ga0415639_299665 | 3300038395 | Unclassified | 1170 |
| 79 | Ga0466693_287393 | 3300042592 | Bacteria | 2377 |
| 80 | Ga0466693_364500 | 3300042592 | Bacteria | 1031 |
| 81 | Ga0466707_135699 | 3300042601 | Bacteria | 1175 |
| 82 | Ga0123355_10000043 | 3300009826 | Bacteria | 124813 |
| 83 | Ga0123355_10105608 | 3300009826 | Bacteria | 4418 |
| 84 | Ga0123355_10273189 | 3300009826 | Bacteria | 2345 |
| 85 | Ga0123355_10401535 | 3300009826 | Bacteria | 1767 |
| 86 | Ga0123353_10061430 | 3300010167 | Bacteria | 6025 |
| 87 | Ga0123353_10124604 | 3300010167 | Bacteria | 4141 |
| 88 | Ga0123353_10211460 | 3300010167 | Bacteria | 3042 |
| 89 | Ga0466693_022693 | 3300042592 | Bacteria | 1909 |
| 90 | Ga0466714_067967 | 3300042603 | Bacteria | 1668 |
| 91 | JGI24703J35330_11745777 | 3300002501 | Bacteria | 4760 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF03591 | AzlC | AzlC protein | 49 | 187 | 0.93 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.