Protein Family IF02940

Metagenome
111 Members
40 Samples
111 Scaffolds
311.77 Avg Length

🧬 Representative Sequence

ID
3300010049|Ga0123356_10652329|Ga0123356_106523291
Length
329 aa
Sequence
VVKYFSFVSLDFFNVLYNFVLKIEEQYPKDFQEFLVQFPDEKSCWHYLISIRWQEGYECLKCQSKKYWLTAKHKMHCCDCNSEFSITSGTIFQDSKKPLLLWFHIIWWVVAQKTGASASNLKDFMGFGSDETAWHWLHKLRRAMVRHGREKLSGVVEVDEAYIGGEEIGKKGRGAEEKSLVIVATECIGKKIGRVRFQIIPDASTENLFSFVENNIEQGSDVITDGWSGYNFLHKSENYNHQEKIIMGSGKEAHELLPHVHLVISLLKRWIYGTHQGKISQKYLEYYLDEFAFRFNRKMSTYRGKLFYRLLQQAVTTPPLPNKNIKKS*

📊 Sample Types

Isolate 0.0%
Metagenome 100.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 71.1%
Kalotermitidae 13.2%
Termopsidae 7.9%
Passalidae 5.3%
Unclassified 2.6%

🌳 Taxonomy

Archaea 0
Bacteria 83
Eukaryota 0
Viruses 1
Unclassified 27

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
2 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
3 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
4 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
5 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
6 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
7 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
8 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
9 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
10 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
11 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
12 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
13 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
14 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
15 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
16 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
17 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
18 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
19 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
20 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
21 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
22 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
23 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
24 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
25 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
26 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
27 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
28 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
29 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
30 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
31 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
32 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
33 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
34 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
35 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
36 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
37 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
38 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
39 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
40 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_044504 3300042612 Unclassified 2097
2 Ga0466734_140417 3300042623 Bacteria 1765
3 Ga0466734_160195 3300042623 Bacteria 1893
4 Ga0466725_369785 3300042654 Unclassified 1500
5 IMNBL1DRAFT_c0060758 3300000062 Unclassified 1137
6 IMNBL1DRAFT_c0066361 3300000062 Unclassified 1059
7 Ga0072941_1060627 3300005201 Bacteria 1541
8 Ga0264413_159626 3300024493 Bacteria 1309
9 Ga0466657_089181 3300042582 Bacteria 14217
10 Ga0466657_141424 3300042582 Bacteria 1178
11 Ga0466693_083496 3300042592 Unclassified 1217
12 Ga0466695_177657 3300042595 Bacteria 1097
13 Ga0466696_249136 3300042596 Bacteria 1246
14 Ga0466710_152760 3300042613 Unclassified 1139
15 Ga0466701_029554 3300042598 Unclassified 1232
16 Ga0466701_041614 3300042598 Bacteria 1422
17 Ga0466717_127100 3300042604 Bacteria 2814
18 Ga0466721_044800 3300042608 Unclassified 1250
19 Ga0123357_10242494 3300009784 Bacteria 1948
20 Ga0123354_10322264 3300010882 Bacteria 1424
21 Ga0123354_10406380 3300010882 Bacteria 1147
22 Ga0466697_177250 3300042611 Bacteria 1193
23 Ga0466697_244381 3300042611 Bacteria 1493
24 Ga0466735_107894 3300042624 Unclassified 1231
25 2227450272 2225789004 Bacteria 1015
26 JGI24702J35022_10204789 3300002462 Bacteria 1131
27 Ga0415639_088322 3300038395 Unclassified 3542
28 Ga0466699_341870 3300042597 Bacteria 1294
29 Ga0466701_000183 3300042598 Bacteria 1668
30 Ga0466721_007451 3300042608 Bacteria 1195
31 Ga0466721_199961 3300042608 Bacteria 1197
32 Ga0466698_330389 3300042610 Bacteria 2107
33 Ga0466697_027460 3300042611 Bacteria 1114
34 Ga0123353_10921152 3300010167 Unclassified 1187
35 Ga0123354_10037010 3300010882 Bacteria 7601
36 Ga0466697_159870 3300042611 Bacteria 1420
37 Ga0466731_281790 3300042622 Bacteria 1249
38 Ga0466703_237636 3300042636 Bacteria 1576
39 Ga0466724_38095 3300042649 Bacteria 1234
40 Ga0466727_214817 3300042655 Bacteria 1871
41 Ga0415639_200055 3300038395 Unclassified 1147
42 Ga0466694_142541 3300042594 Bacteria 3341
43 Ga0466694_402226 3300042594 Bacteria 1882
44 Ga0466710_172080 3300042613 Bacteria 1899
45 Ga0466711_513155 3300042615 Bacteria 2489
46 Ga0466726_250993 3300042619 Bacteria 1778
47 Ga0466721_004961 3300042608 Bacteria 1060
48 Ga0466721_163393 3300042608 Bacteria 1368
49 Ga0123357_10228362 3300009784 Bacteria 2047
50 Ga0123355_10667673 3300009826 Bacteria 1206
51 Ga0123356_10419273 3300010049 Bacteria 1480
52 Ga0123356_10652329 3300010049 Bacteria 1220
53 Ga0123353_10358003 3300010167 Unclassified 2194
54 Ga0123354_10433623 3300010882 Unclassified 1080
55 Ga0466697_171034 3300042611 Bacteria 1191
56 Ga0466731_022133 3300042622 Bacteria 1993
57 Ga0466731_421577 3300042622 Unclassified 1391
58 Ga0466725_312296 3300042654 Bacteria 1357
59 2227297746 2225789004 Unclassified 1228
60 JGI24695J34938_10108254 3300002450 Unclassified 1133
61 JGI24702J35022_10007726 3300002462 Bacteria 6138
62 Ga0466694_147569 3300042594 Bacteria 1596
63 Ga0466700_383228 3300042600 Bacteria 1809
64 Ga0466721_002574 3300042608 Bacteria 1117
65 Ga0123354_10273406 3300010882 Bacteria 1657
66 Ga0466731_250537 3300042622 Bacteria 1330
67 Ga0466704_483691 3300042643 Bacteria 1301
68 Ga0466725_432845 3300042654 Bacteria 1183
69 JGI24698J34947_10133230 3300002449 Unclassified 1058
70 JGI24695J34938_10121754 3300002450 Bacteria 1062
71 JGI24696J40584_12857803 3300002834 Bacteria 1001
72 Ga0466695_005525 3300042595 Bacteria 1226
73 Ga0466710_399554 3300042613 Bacteria 1658
74 Ga0466698_425117 3300042610 Bacteria 2065
75 Ga0466697_001046 3300042611 Bacteria 1243
76 Ga0123353_10414790 3300010167 Bacteria 1998
77 Ga0123354_10222934 3300010882 Unclassified 1997
78 Ga0123354_10467810 3300010882 Bacteria 1007
79 Ga0466697_126966 3300042611 Bacteria 1151
80 Ga0466731_223130 3300042622 Bacteria 1582
81 Ga0466731_277129 3300042622 Unclassified 1534
82 Ga0466656_160783 3300042550 Bacteria 1865
83 Ga0466693_089500 3300042592 Bacteria 1254
84 Ga0466710_126730 3300042613 Bacteria 1245
85 Ga0466710_309599 3300042613 Bacteria 1383
86 Ga0466701_091326 3300042598 Unclassified 1263
87 Ga0123356_10253317 3300010049 Unclassified 1839
88 Ga0123356_10678706 3300010049 Unclassified 1198
89 Ga0123354_10400123 3300010882 Unclassified 1163
90 Ga0466697_267662 3300042611 Bacteria 1122
91 Ga0466724_07737 3300042649 Unclassified 1178
92 JGI24695J34938_10110128 3300002450 Bacteria 1122
93 Ga0466710_027825 3300042613 Bacteria 1471
94 Ga0466711_510500 3300042615 Unclassified 1003
95 Ga0466707_021911 3300042601 Bacteria 6143
96 Ga0466698_350422 3300042610 Bacteria 2261
97 Ga0466697_150370 3300042611 Bacteria 1449
98 Ga0466731_118557 3300042622 Bacteria 1174
99 Ga0466731_156080 3300042622 Bacteria 1346
100 Ga0466734_004254 3300042623 Bacteria 1731
101 Ga0466734_037186 3300042623 Bacteria 1052
102 Ga0466734_158051 3300042623 Unclassified 1208
103 Ga0466725_396909 3300042654 Bacteria 1460
104 Ga0466725_429978 3300042654 Viruses 1942
105 Ga0072941_1072452 3300005201 Bacteria 1298
106 Ga0466656_026405 3300042550 Bacteria 1418
107 Ga0466693_091165 3300042592 Bacteria 1575
108 Ga0466701_046068 3300042598 Bacteria 1271
109 Ga0466717_029187 3300042604 Bacteria 2890
110 Ga0123357_10333264 3300009784 Bacteria 1479
111 Ga0123356_10332849 3300010049 Bacteria 1636

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042592 Ga0466693_083496 Ga0466693_083496_24_953 295
2 3300042623 Ga0466734_004254 Ga0466734_004254_278_1165 295
3 2225789004 2227297746 2227748035 297
4 3300009826 Ga0123355_10667673 Ga0123355_106676732 302
5 3300042598 Ga0466701_046068 Ga0466701_046068_173_1084 303
6 3300042604 Ga0466717_029187 Ga0466717_029187_287_1237 303
7 3300038395 Ga0415639_200055 Ga0415639_200055_43_972 309
8 3300042594 Ga0466694_142541 Ga0466694_142541_1910_2839 309
9 3300042594 Ga0466694_147569 Ga0466694_147569_412_1341 309
10 3300042594 Ga0466694_402226 Ga0466694_402226_545_1474 309
11 3300042595 Ga0466695_005525 Ga0466695_005525_229_1158 309
12 3300042596 Ga0466696_249136 Ga0466696_249136_171_1100 309
13 3300042601 Ga0466707_021911 Ga0466707_021911_5191_6120 309
14 3300042608 Ga0466721_163393 Ga0466721_163393_308_1237 309
15 3300042610 Ga0466698_350422 Ga0466698_350422_493_1422 309
16 3300042613 Ga0466710_172080 Ga0466710_172080_307_1236 309
17 3300042615 Ga0466711_510500 Ga0466711_510500_50_979 309
18 3300042622 Ga0466731_250537 Ga0466731_250537_217_1146 309
19 3300042623 Ga0466734_160195 Ga0466734_160195_564_1493 309
20 3300042636 Ga0466703_237636 Ga0466703_237636_162_1091 309
21 3300042649 Ga0466724_38095 Ga0466724_38095_166_1095 309
22 3300042654 Ga0466725_369785 Ga0466725_369785_480_1409 309
23 3300042654 Ga0466725_432845 Ga0466725_432845_52_981 309
24 3300042655 Ga0466727_214817 Ga0466727_214817_463_1392 309
25 3300002450 JGI24695J34938_10110128 JGI24695J34938_101101281 310
26 3300002450 JGI24695J34938_10121754 JGI24695J34938_101217541 310
27 3300002462 JGI24702J35022_10204789 JGI24702J35022_102047891 310
28 3300010049 Ga0123356_10253317 Ga0123356_102533172 310
29 3300010049 Ga0123356_10332849 Ga0123356_103328493 310
30 3300010167 Ga0123353_10414790 Ga0123353_104147902 310
31 3300010882 Ga0123354_10037010 Ga0123354_100370103 310
32 3300010882 Ga0123354_10222934 Ga0123354_102229341 310
33 3300010882 Ga0123354_10433623 Ga0123354_104336231 310
34 3300024493 Ga0264413_159626 Ga0264413_1596262 310
35 3300042550 Ga0466656_026405 Ga0466656_026405_342_1274 310
36 3300042592 Ga0466693_091165 Ga0466693_091165_149_1081 310
37 3300042595 Ga0466695_177657 Ga0466695_177657_104_1036 310
38 3300042598 Ga0466701_000183 Ga0466701_000183_590_1522 310
39 3300042598 Ga0466701_041614 Ga0466701_041614_158_1090 310
40 3300042608 Ga0466721_199961 Ga0466721_199961_126_1058 310
41 3300042610 Ga0466698_330389 Ga0466698_330389_343_1275 310
42 3300042611 Ga0466697_027460 Ga0466697_027460_52_984 310
43 3300042611 Ga0466697_159870 Ga0466697_159870_300_1232 310
44 3300042611 Ga0466697_177250 Ga0466697_177250_147_1079 310
45 3300042611 Ga0466697_267662 Ga0466697_267662_167_1099 310
46 3300042612 Ga0466705_044504 Ga0466705_044504_326_1258 310
47 3300042613 Ga0466710_027825 Ga0466710_027825_358_1290 310
48 3300042613 Ga0466710_399554 Ga0466710_399554_482_1414 310
49 3300042622 Ga0466731_156080 Ga0466731_156080_181_1113 310
50 3300042622 Ga0466731_223130 Ga0466731_223130_509_1441 310
51 3300042622 Ga0466731_281790 Ga0466731_281790_53_985 310
52 3300042623 Ga0466734_037186 Ga0466734_037186_72_1004 310
53 3300042654 Ga0466725_396909 Ga0466725_396909_95_1027 310
54 3300002462 JGI24702J35022_10007726 JGI24702J35022_100077262 311
55 3300002834 JGI24696J40584_12857803 JGI24696J40584_128578031 311
56 3300005201 Ga0072941_1072452 Ga0072941_10724521 311
57 3300009784 Ga0123357_10228362 Ga0123357_102283621 311
58 3300010167 Ga0123353_10921152 Ga0123353_109211521 311
59 3300010882 Ga0123354_10467810 Ga0123354_104678101 311
60 3300042615 Ga0466711_513155 Ga0466711_513155_1540_2475 311
61 3300042623 Ga0466734_158051 Ga0466734_158051_181_1116 311
62 3300042624 Ga0466735_107894 Ga0466735_107894_187_1122 311
63 3300000062 IMNBL1DRAFT_c0060758 IMNBL1DRAFT_00607582 312
64 3300005201 Ga0072941_1060627 Ga0072941_10606273 312
65 3300038395 Ga0415639_088322 Ga0415639_088322_2527_3465 312
66 3300042582 Ga0466657_141424 Ga0466657_141424_141_1079 312
67 3300042604 Ga0466717_127100 Ga0466717_127100_690_1628 312
68 3300042608 Ga0466721_004961 Ga0466721_004961_34_972 312
69 3300042611 Ga0466697_001046 Ga0466697_001046_225_1163 312
70 3300042619 Ga0466726_250993 Ga0466726_250993_674_1612 312
71 3300042623 Ga0466734_140417 Ga0466734_140417_505_1443 312
72 3300010882 Ga0123354_10273406 Ga0123354_102734062 313
73 3300042550 Ga0466656_160783 Ga0466656_160783_100_1041 313
74 3300042582 Ga0466657_089181 Ga0466657_089181_10459_11400 313
75 3300042598 Ga0466701_029554 Ga0466701_029554_161_1102 313
76 3300042598 Ga0466701_091326 Ga0466701_091326_149_1090 313
77 3300042600 Ga0466700_383228 Ga0466700_383228_97_1038 313
78 3300042608 Ga0466721_002574 Ga0466721_002574_158_1099 313
79 3300042611 Ga0466697_126966 Ga0466697_126966_119_1060 313
80 3300042611 Ga0466697_171034 Ga0466697_171034_119_1060 313
81 3300042613 Ga0466710_152760 Ga0466710_152760_149_1090 313
82 3300042613 Ga0466710_309599 Ga0466710_309599_272_1213 313
83 3300042622 Ga0466731_277129 Ga0466731_277129_141_1082 313
84 3300042649 Ga0466724_07737 Ga0466724_07737_99_1040 313
85 3300042654 Ga0466725_429978 Ga0466725_429978_952_1893 313
86 3300002449 JGI24698J34947_10133230 JGI24698J34947_101332301 314
87 3300002450 JGI24695J34938_10108254 JGI24695J34938_101082541 314
88 3300009784 Ga0123357_10242494 Ga0123357_102424941 314
89 3300009784 Ga0123357_10333264 Ga0123357_103332642 314
90 3300010167 Ga0123353_10358003 Ga0123353_103580032 314
91 3300010882 Ga0123354_10400123 Ga0123354_104001231 314
92 3300042611 Ga0466697_244381 Ga0466697_244381_311_1255 314
93 2225789004 2227450272 2227887409 315
94 3300042597 Ga0466699_341870 Ga0466699_341870_217_1164 315
95 3300042608 Ga0466721_007451 Ga0466721_007451_125_1072 315
96 3300042608 Ga0466721_044800 Ga0466721_044800_194_1141 315
97 3300042622 Ga0466731_022133 Ga0466731_022133_788_1735 315
98 3300000062 IMNBL1DRAFT_c0066361 IMNBL1DRAFT_00663611 316
99 3300042610 Ga0466698_425117 Ga0466698_425117_438_1388 316
100 3300042611 Ga0466697_150370 Ga0466697_150370_169_1119 316
101 3300042613 Ga0466710_126730 Ga0466710_126730_184_1134 316
102 3300042643 Ga0466704_483691 Ga0466704_483691_258_1208 316
103 3300042654 Ga0466725_312296 Ga0466725_312296_280_1230 316
104 3300010049 Ga0123356_10419273 Ga0123356_104192732 317
105 3300010049 Ga0123356_10678706 Ga0123356_106787061 317
106 3300010882 Ga0123354_10322264 Ga0123354_103222641 317
107 3300010882 Ga0123354_10406380 Ga0123354_104063801 317
108 3300042592 Ga0466693_089500 Ga0466693_089500_154_1107 317
109 3300010049 Ga0123356_10652329 Ga0123356_106523291 329
110 3300042622 Ga0466731_421577 Ga0466731_421577_63_1079 338
111 3300042622 Ga0466731_118557 Ga0466731_118557_98_1147 349

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF12762 DDE_Tnp_IS1595 ISXO2-like transposase domain 151 296 0.9

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.77 0.81 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.