Protein Family IF02923
Metagenome
Metatranscriptome
Isolate
205
Members
82
Samples
181
Scaffolds
97.55
Avg Length
Representative Sequence
- ID
- 3300010049|Ga0123356_10492614|Ga0123356_104926142
- Length
- 107 aa
- Sequence
- MTTNIVRSTVGKGYDIIIRPVLSEKSFSTIKQKMYTFEVHKDATKPQIKKAVEEVFKVKVEKVNTANYDGKPKRHGRSEGTRPDWKKAYVQLTKESKPIEFFESLQ*
Sample Types
Isolate
11.7%
Metagenome
86.3%
MAG
0.0%
Metatranscriptome
1.9%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
32.1%
Unclassified
23.1%
Kalotermitidae
16.7%
Apidae
7.7%
Termopsidae
5.1%
Rhinotermitidae
3.8%
Passalidae
3.8%
Drosophilidae
1.3%
Hodotermitidae
1.3%
Scarabaeidae
1.3%
Tenebrionidae
1.3%
Culicidae
1.3%
Formicidae
1.3%
Taxonomy
Archaea
0
Bacteria
192
Eukaryota
0
Viruses
0
Unclassified
13
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820252425 | Unclassified Firmicutes Th196P3bin6 | Isolate | Unclassified |
| 2 | 2820468515 | Unclassified Firmicutes Lab288P1bin95 | Isolate | Unclassified |
| 3 | 2902668162 | Lacticaseibacillus paracasei DmW_181 | Isolate | Drosophilidae |
| 4 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 5 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 6 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 7 | 3300021244 | Termite gut microbial communities from nest from French Guiana - 12-6 mRNA SA | Metatranscriptome | Termitidae |
| 8 | 3300022820 | Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA | Metatranscriptome | Termitidae |
| 9 | 2597490239 | Bifidobacterium bohemicum DSM 22767 | Isolate | Unclassified |
| 10 | 2663763384 | Bifidobacterium bombi DSM 19703 | Isolate | Apidae |
| 11 | 2820669764 | Unclassified Firmicutes Co191P3bin30 | Isolate | Unclassified |
| 12 | 2865983822 | Bifidobacterium xylocopae XV2 | Isolate | Apidae |
| 13 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 14 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 15 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 16 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 17 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 18 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 19 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 20 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 21 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 22 | 2645727657 | Bifidobacterium actinocoloniiforme DSM 22766 | Isolate | Unclassified |
| 23 | 2820476618 | Unclassified Firmicutes Lab288P1bin80 | Isolate | Unclassified |
| 24 | 2824199081 | Bifidobacterium commune DSM 28792 | Isolate | Unclassified |
| 25 | 2865982043 | Bifidobacterium aemilianum XV10 | Isolate | Apidae |
| 26 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 27 | 651324002 | Acetonema longum APO-1, DSM 6540 | Isolate | Kalotermitidae |
| 28 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 29 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 30 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 31 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 32 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 33 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 34 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 35 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 36 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 37 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 38 | 2820651690 | Unclassified Firmicutes Cu122P3bin6 | Isolate | Unclassified |
| 39 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 40 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 41 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 42 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 43 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 44 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 45 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 46 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 47 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 48 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 49 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 50 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 51 | 2820576413 | Unclassified Firmicutes Emb289P3bin136 | Isolate | Unclassified |
| 52 | 2820903739 | Unclassified Actinobacteria Emb289P4bin49 | Isolate | Unclassified |
| 53 | 2852337885 | Paenibacillus protaetiae FW100M-2 | Isolate | Scarabaeidae |
| 54 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 55 | 2636416028 | Pelosinus propionicus DSM 13327 | Isolate | Unclassified |
| 56 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 57 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 58 | 2989309576 | Sporomusa termitida DSM 4440 | Isolate | Unclassified |
| 59 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 60 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 61 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 62 | 3300021240 | Termite gut microbial communities from nest from French Guiana - 11-5 mRNA SA | Metatranscriptome | Termitidae |
| 63 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 64 | 2820506701 | Unclassified Firmicutes Lab288P1bin46 | Isolate | Unclassified |
| 65 | 2820525019 | Unclassified Firmicutes Lab288P1bin2 | Isolate | Unclassified |
| 66 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 67 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 68 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 69 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 70 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 71 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 72 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 73 | 2600255079 | Bifidobacterium bombi DSM 19703 | Isolate | Apidae |
| 74 | 2820497731 | Unclassified Firmicutes Lab288P1bin55 | Isolate | Unclassified |
| 75 | 2820572885 | Unclassified Firmicutes Emb289P3bin161 | Isolate | Unclassified |
| 76 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 77 | 8032009961 | Bifidobacterium indicum ESL0197 | Isolate | Apidae |
| 78 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 79 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 80 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 81 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 82 | 3300026175 | Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 | Metagenome | Formicidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466715_339223 | 3300042616 | Bacteria | 59419 |
| 2 | Ga0466718_080151 | 3300042617 | Bacteria | 3259 |
| 3 | Ga0466726_190545 | 3300042619 | Bacteria | 5076 |
| 4 | Ga0123355_10230801 | 3300009826 | Bacteria | 2643 |
| 5 | Ga0123355_10270954 | 3300009826 | Bacteria | 2359 |
| 6 | Ga0123355_11301774 | 3300009826 | Bacteria | 729 |
| 7 | Ga0123356_11364932 | 3300010049 | Bacteria | 870 |
| 8 | Ga0123356_11937522 | 3300010049 | Bacteria | 734 |
| 9 | Ga0123356_12889394 | 3300010049 | Bacteria | 601 |
| 10 | Ga0123353_10017331 | 3300010167 | Bacteria | 10582 |
| 11 | Ga0123353_10119969 | 3300010167 | Bacteria | 4229 |
| 12 | Ga0123353_10124561 | 3300010167 | Bacteria | 4142 |
| 13 | Ga0123353_11293518 | 3300010167 | Bacteria | 947 |
| 14 | Ga0123353_11742143 | 3300010167 | Bacteria | 778 |
| 15 | Ga0123353_12337374 | 3300010167 | Bacteria | 641 |
| 16 | Ga0466735_074178 | 3300042624 | Bacteria | 1218 |
| 17 | Ga0466735_135663 | 3300042624 | Bacteria | 1187 |
| 18 | Ga0466704_073736 | 3300042643 | Bacteria | 9570 |
| 19 | Ga0466727_034751 | 3300042655 | Bacteria | 11324 |
| 20 | Ga0160470_100276 | 3300012813 | Bacteria | 34847 |
| 21 | Ga0466691_209977 | 3300042593 | Bacteria | 1320 |
| 22 | Ga0466699_409111 | 3300042597 | Bacteria | 2759 |
| 23 | FGTW_contig14754 | 2065487013 | Bacteria | 961 |
| 24 | IMNBL1DRAFT_c0001685 | 3300000062 | Bacteria | 16309 |
| 25 | JGI24698J34947_10033203 | 3300002449 | Bacteria | 2708 |
| 26 | Ga0072941_1553550 | 3300005201 | Bacteria | 1132 |
| 27 | Ga0466697_010722 | 3300042611 | Bacteria | 1023 |
| 28 | Ga0466711_051724 | 3300042615 | Bacteria | 11431 |
| 29 | Ga0466711_257614 | 3300042615 | Bacteria | 3272 |
| 30 | Ga0466723_030317 | 3300042618 | Bacteria | 4106 |
| 31 | Ga0466723_315712 | 3300042618 | Bacteria | 6485 |
| 32 | Ga0123355_10000012 | 3300009826 | Bacteria | 181780 |
| 33 | Ga0123355_10021485 | 3300009826 | Bacteria | 10331 |
| 34 | Ga0123355_10409068 | 3300009826 | Bacteria | 1743 |
| 35 | Ga0123356_10337073 | 3300010049 | Bacteria | 1627 |
| 36 | Ga0123356_10582665 | 3300010049 | Bacteria | 1282 |
| 37 | Ga0123356_11811019 | 3300010049 | Bacteria | 759 |
| 38 | Ga0123353_10564971 | 3300010167 | Bacteria | 1637 |
| 39 | Ga0123353_10916889 | 3300010167 | Unclassified | 1190 |
| 40 | Ga0123354_10670078 | 3300010882 | Bacteria | 734 |
| 41 | Ga0466703_240203 | 3300042636 | Unclassified | 1914 |
| 42 | Ga0466708_274375 | 3300042652 | Bacteria | 21022 |
| 43 | Ga0223686_1085537 | 3300021244 | Bacteria | 708 |
| 44 | Ga0255809_1004751 | 3300022820 | Bacteria | 1808 |
| 45 | Ga0255809_1004753 | 3300022820 | Bacteria | 745 |
| 46 | Ga0415639_042410 | 3300038395 | Bacteria | 1989 |
| 47 | Ga0466691_056146 | 3300042593 | Bacteria | 34897 |
| 48 | JGI24702J35022_10149150 | 3300002462 | Bacteria | 1311 |
| 49 | Ga0466706_049052 | 3300042599 | Bacteria | 1424 |
| 50 | Ga0466707_281543 | 3300042601 | Bacteria | 1906 |
| 51 | Ga0466714_147613 | 3300042603 | Bacteria | 2504 |
| 52 | Ga0466698_219164 | 3300042610 | Bacteria | 2445 |
| 53 | Ga0466705_271435 | 3300042612 | Bacteria | 3563 |
| 54 | Ga0466711_345094 | 3300042615 | Bacteria | 14257 |
| 55 | Ga0466711_425700 | 3300042615 | Bacteria | 6307 |
| 56 | Ga0466715_375631 | 3300042616 | Bacteria | 2571 |
| 57 | Ga0466723_043688 | 3300042618 | Bacteria | 3654 |
| 58 | Ga0466723_202062 | 3300042618 | Bacteria | 13376 |
| 59 | Ga0466726_353337 | 3300042619 | Bacteria | 59989 |
| 60 | Ga0123355_10010726 | 3300009826 | Bacteria | 14078 |
| 61 | Ga0123355_10276050 | 3300009826 | Bacteria | 2327 |
| 62 | Ga0123355_10424356 | 3300009826 | Bacteria | 1697 |
| 63 | Ga0123355_10632316 | 3300009826 | Bacteria | 1257 |
| 64 | Ga0123355_11367303 | 3300009826 | Bacteria | 703 |
| 65 | Ga0123356_10011213 | 3300010049 | Bacteria | 8751 |
| 66 | Ga0123356_11042455 | 3300010049 | Bacteria | 987 |
| 67 | Ga0123356_13723486 | 3300010049 | Bacteria | 527 |
| 68 | Ga0123353_11069572 | 3300010167 | Bacteria | 1075 |
| 69 | Ga0123353_11921284 | 3300010167 | Bacteria | 729 |
| 70 | Ga0123354_10356485 | 3300010882 | Unclassified | 1296 |
| 71 | Ga0466735_116906 | 3300042624 | Bacteria | 1237 |
| 72 | Ga0466708_207293 | 3300042652 | Bacteria | 33526 |
| 73 | Ga0223684_1062946 | 3300021240 | Bacteria | 587 |
| 74 | Ga0415639_051277 | 3300038395 | Bacteria | 20381 |
| 75 | JGI24702J35022_10001245 | 3300002462 | Bacteria | 15858 |
| 76 | Ga0123357_10003044 | 3300009784 | Bacteria | 19002 |
| 77 | Ga0466707_159504 | 3300042601 | Bacteria | 2640 |
| 78 | Ga0466713_021451 | 3300042602 | Bacteria | 1707 |
| 79 | Ga0466717_151415 | 3300042604 | Unclassified | 1554 |
| 80 | Ga0466716_367538 | 3300042605 | Bacteria | 2860 |
| 81 | Ga0466705_095369 | 3300042612 | Bacteria | 1630 |
| 82 | Ga0466732_368493 | 3300042656 | Bacteria | 1446 |
| 83 | Ga0466711_044977 | 3300042615 | Bacteria | 1187 |
| 84 | Ga0466711_184685 | 3300042615 | Bacteria | 9250 |
| 85 | Ga0123356_10002129 | 3300010049 | Bacteria | 21360 |
| 86 | Ga0123356_10688493 | 3300010049 | Bacteria | 1191 |
| 87 | Ga0123356_12066937 | 3300010049 | Bacteria | 711 |
| 88 | Ga0123353_10390111 | 3300010167 | Bacteria | 2078 |
| 89 | Ga0123353_12987881 | 3300010167 | Bacteria | 548 |
| 90 | Ga0466735_073169 | 3300042624 | Bacteria | 1011 |
| 91 | Ga0466694_241440 | 3300042594 | Bacteria | 37091 |
| 92 | 2227022067 | 2225789003 | Bacteria | 1011 |
| 93 | IMNBL1DRAFT_c0000311 | 3300000062 | Bacteria | 41422 |
| 94 | Ga0068302_10006864 | 3300005071 | Bacteria | 2932 |
| 95 | Ga0466707_237827 | 3300042601 | Bacteria | 1695 |
| 96 | Ga0466711_181111 | 3300042615 | Bacteria | 1435 |
| 97 | Ga0466711_189579 | 3300042615 | Bacteria | 1540 |
| 98 | Ga0466715_571989 | 3300042616 | Bacteria | 2307 |
| 99 | Ga0466726_207501 | 3300042619 | Bacteria | 8201 |
| 100 | Ga0466726_424569 | 3300042619 | Bacteria | 1220 |
| 101 | Ga0123355_10022600 | 3300009826 | Bacteria | 10083 |
| 102 | Ga0123355_10112402 | 3300009826 | Bacteria | 4251 |
| 103 | Ga0123355_10725260 | 3300009826 | Bacteria | 1132 |
| 104 | Ga0123355_10769257 | 3300009826 | Bacteria | 1083 |
| 105 | Ga0123356_11405905 | 3300010049 | Bacteria | 858 |
| 106 | Ga0123353_12000879 | 3300010167 | Bacteria | 710 |
| 107 | Ga0466731_176795 | 3300042622 | Bacteria | 2227 |
| 108 | Ga0466709_109609 | 3300042648 | Bacteria | 1941 |
| 109 | Ga0466708_084964 | 3300042652 | Bacteria | 3228 |
| 110 | Ga0466691_201130 | 3300042593 | Bacteria | 16704 |
| 111 | Ga0466694_183507 | 3300042594 | Bacteria | 1259 |
| 112 | JGI24695J34938_10000226 | 3300002450 | Bacteria | 53266 |
| 113 | Ga0072941_1213393 | 3300005201 | Bacteria | 645 |
| 114 | Ga0074278_142794 | 3300005721 | Bacteria | 8443 |
| 115 | Ga0466706_155979 | 3300042599 | Bacteria | 1978 |
| 116 | Ga0466707_136777 | 3300042601 | Bacteria | 2281 |
| 117 | Ga0466714_121100 | 3300042603 | Unclassified | 3077 |
| 118 | Ga0466726_449942 | 3300042619 | Unclassified | 2157 |
| 119 | Ga0466728_468143 | 3300042620 | Unclassified | 1143 |
| 120 | Ga0123355_10093265 | 3300009826 | Bacteria | 4766 |
| 121 | Ga0123355_10477545 | 3300009826 | Bacteria | 1553 |
| 122 | Ga0123356_10364430 | 3300010049 | Bacteria | 1573 |
| 123 | Ga0123356_11229873 | 3300010049 | Bacteria | 914 |
| 124 | Ga0123356_12235595 | 3300010049 | Bacteria | 684 |
| 125 | Ga0123353_10054303 | 3300010167 | Bacteria | 6406 |
| 126 | Ga0123353_10167597 | 3300010167 | Bacteria | 3490 |
| 127 | Ga0123353_10670500 | 3300010167 | Bacteria | 1463 |
| 128 | Ga0415639_067653 | 3300038395 | Unclassified | 17962 |
| 129 | Ga0415639_113417 | 3300038395 | Bacteria | 1347 |
| 130 | Ga0466692_078337 | 3300042591 | Bacteria | 9721 |
| 131 | JGI24696J40584_12864744 | 3300002834 | Bacteria | 1024 |
| 132 | Ga0466701_089953 | 3300042598 | Bacteria | 1512 |
| 133 | Ga0466706_135974 | 3300042599 | Bacteria | 1820 |
| 134 | Ga0466697_156514 | 3300042611 | Bacteria | 1167 |
| 135 | Ga0466705_115618 | 3300042612 | Bacteria | 24638 |
| 136 | Ga0466705_137566 | 3300042612 | Bacteria | 2802 |
| 137 | Ga0466718_148149 | 3300042617 | Bacteria | 6754 |
| 138 | Ga0466726_411353 | 3300042619 | Bacteria | 1844 |
| 139 | Ga0466726_452480 | 3300042619 | Bacteria | 13818 |
| 140 | Ga0466728_017461 | 3300042620 | Bacteria | 2635 |
| 141 | Ga0123357_10193154 | 3300009784 | Bacteria | 2339 |
| 142 | Ga0123355_10290401 | 3300009826 | Bacteria | 2245 |
| 143 | Ga0123355_11975833 | 3300009826 | Bacteria | 542 |
| 144 | Ga0123356_10122097 | 3300010049 | Bacteria | 2536 |
| 145 | Ga0123356_10492614 | 3300010049 | Bacteria | 1380 |
| 146 | Ga0123356_10817814 | 3300010049 | Bacteria | 1103 |
| 147 | Ga0123354_10543163 | 3300010882 | Unclassified | 881 |
| 148 | Ga0466708_094476 | 3300042652 | Unclassified | 3077 |
| 149 | Ga0466708_215505 | 3300042652 | Bacteria | 16232 |
| 150 | Ga0264413_134817 | 3300024493 | Bacteria | 3183 |
| 151 | Ga0466696_369917 | 3300042596 | Bacteria | 1114 |
| 152 | 2227569076 | 2225789004 | Bacteria | 14054 |
| 153 | Ga0562377_0060 | 3300056842 | Bacteria | 477040 |
| 154 | Ga0466705_411844 | 3300042612 | Bacteria | 13683 |
| 155 | Ga0466715_097471 | 3300042616 | Bacteria | 21526 |
| 156 | Ga0466715_586248 | 3300042616 | Bacteria | 20520 |
| 157 | Ga0466726_189863 | 3300042619 | Bacteria | 7257 |
| 158 | Ga0466726_408314 | 3300042619 | Bacteria | 25305 |
| 159 | Ga0466726_442289 | 3300042619 | Bacteria | 1057 |
| 160 | Ga0466728_008267 | 3300042620 | Bacteria | 4652 |
| 161 | Ga0466728_127136 | 3300042620 | Bacteria | 23734 |
| 162 | Ga0466729_028580 | 3300042621 | Bacteria | 5717 |
| 163 | Ga0123355_10125205 | 3300009826 | Bacteria | 3973 |
| 164 | Ga0123355_10568096 | 3300009826 | Bacteria | 1362 |
| 165 | Ga0123355_10771796 | 3300009826 | Bacteria | 1080 |
| 166 | Ga0123356_10006092 | 3300010049 | Bacteria | 12232 |
| 167 | Ga0123353_10146720 | 3300010167 | Bacteria | 3772 |
| 168 | Ga0123353_10613023 | 3300010167 | Bacteria | 1552 |
| 169 | Ga0123353_11103112 | 3300010167 | Bacteria | 1053 |
| 170 | Ga0123353_11303630 | 3300010167 | Bacteria | 943 |
| 171 | Ga0160454_100150 | 3300012798 | Bacteria | 83122 |
| 172 | Ga0255572_1000024 | 3300026175 | Bacteria | 128087 |
| 173 | Ga0415639_048393 | 3300038395 | Unclassified | 1986 |
| 174 | Ga0415639_182586 | 3300038395 | Bacteria | 1179 |
| 175 | Ga0466693_207011 | 3300042592 | Bacteria | 1213 |
| 176 | Ga0466693_273731 | 3300042592 | Unclassified | 2931 |
| 177 | JGI24696J40584_12451043 | 3300002834 | Unclassified | 576 |
| 178 | Ga0072941_1334393 | 3300005201 | Bacteria | 857 |
| 179 | Ga0466700_194933 | 3300042600 | Bacteria | 1185 |
| 180 | Ga0466707_151385 | 3300042601 | Bacteria | 1579 |
| 181 | Ga0466722_136872 | 3300042609 | Bacteria | 1953 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00276 | Ribosomal_L23 | Ribosomal protein L23 | 15 | 97 | 0.95 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.