Protein Family IF02915
Metagenome
Isolate
165
Members
71
Samples
144
Scaffolds
207.48
Avg Length
Representative Sequence
- ID
- 3300010049|Ga0123356_10444375|Ga0123356_104443751
- Length
- 235 aa
- Sequence
- LIFESIVSFITFVSYKLTNIFLTDMDNDVNMLKFYFPGMTDEQSQQFDALGDSYASWNAMINVISRKDIDNLYERHVLHSLGIARFIRFTAGTRIMDAGTGGGFPGIPLAILLPEVAFHLVDSVGKKIKVAQSVADVLGLKNVTTRHCRIEDEKNAFDFVVSRAVMTLPELAKLVRKNIAKTQHNALPNGLICLKGGNVNKETTPFGKNVIVADLSEYFAEPYFETKKIIYVPL*
Sample Types
Isolate
12.7%
Metagenome
87.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
29.6%
Kalotermitidae
19.7%
Unclassified
9.9%
Elmidae
9.9%
Culicidae
5.6%
Rhinotermitidae
5.6%
Termopsidae
5.6%
Passalidae
2.8%
Blattidae
2.8%
Formicidae
2.8%
Hodotermitidae
1.4%
Apidae
1.4%
Daphniidae
1.4%
Cambaridae
1.4%
Taxonomy
Archaea
1
Bacteria
160
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 8114076984 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 2 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 3 | 2864788197 | Elizabethkingia anophelis S00027 | Isolate | Elmidae |
| 4 | 2864822740 | Chryseobacterium shigense S00064 | Isolate | Elmidae |
| 5 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 6 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 7 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 8 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 9 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 10 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 11 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 12 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 13 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 14 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 15 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 16 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 17 | 2529292732 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 18 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 19 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 20 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 21 | 2687453786 | Chryseobacterium culicis DSM 23031 | Isolate | Unclassified |
| 22 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 23 | 2847090942 | Elizabethkingia anophelis Ag1 | Isolate | Culicidae |
| 24 | 2864882932 | Chryseobacterium shingense S00136 | Isolate | Elmidae |
| 25 | 2864891731 | Chryseobacterium defluvii S00151 | Isolate | Elmidae |
| 26 | 643348524 | Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 | Isolate | Unclassified |
| 27 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 28 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 29 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 30 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 31 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 32 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 33 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 34 | 2864831662 | Chryseobacterium sediminis S00068 | Isolate | Elmidae |
| 35 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 36 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 37 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 38 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 39 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 40 | 8020009074 | Elizabethkingia anophelis MSU001 | Isolate | Culicidae |
| 41 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 42 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 43 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 44 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 45 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 46 | 2590828803 | Pedobacter glucosidilyticus DD6b | Isolate | Daphniidae |
| 47 | 2864948220 | Elizabethkingia anophelis S00205 | Isolate | Elmidae |
| 48 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 49 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 50 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 51 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 52 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 53 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 54 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 55 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 56 | 2864923010 | Elizabethkingia anophelis S00177 | Isolate | Elmidae |
| 57 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 58 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 59 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 60 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 61 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 62 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 63 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 64 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 65 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 66 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 67 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 68 | 2921902974 | Chryseobacterium sp. cx-624 | Isolate | Cambaridae |
| 69 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 70 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 71 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_083305 | 3300042659 | Bacteria | 99179 |
| 2 | Ga0466713_056740 | 3300042602 | Bacteria | 3831 |
| 3 | Ga0123357_10554571 | 3300009784 | Bacteria | 914 |
| 4 | Ga0123354_10464017 | 3300010882 | Bacteria | 1015 |
| 5 | Ga0466696_084405 | 3300042596 | Bacteria | 2291 |
| 6 | Ga0466710_076999 | 3300042613 | Bacteria | 1628 |
| 7 | Ga0466726_084517 | 3300042619 | Bacteria | 4963 |
| 8 | IMNBL1DRAFT_c0000013 | 3300000062 | Bacteria | 180832 |
| 9 | Ga0466735_047968 | 3300042624 | Bacteria | 5356 |
| 10 | Ga0466735_056052 | 3300042624 | Bacteria | 1347 |
| 11 | Ga0466735_106716 | 3300042624 | Archaea | 1751 |
| 12 | Ga0466704_244636 | 3300042643 | Bacteria | 19020 |
| 13 | Ga0466727_278287 | 3300042655 | Bacteria | 4905 |
| 14 | Ga0466706_093080 | 3300042599 | Bacteria | 1402 |
| 15 | Ga0466713_032013 | 3300042602 | Bacteria | 64924 |
| 16 | Ga0466716_016748 | 3300042605 | Bacteria | 11880 |
| 17 | Ga0466716_065108 | 3300042605 | Bacteria | 6086 |
| 18 | Ga0123354_10000656 | 3300010882 | Bacteria | 36511 |
| 19 | Ga0466692_184435 | 3300042591 | Bacteria | 106081 |
| 20 | Ga0466715_051231 | 3300042616 | Bacteria | 18964 |
| 21 | Ga0466726_178537 | 3300042619 | Bacteria | 6018 |
| 22 | IMNBL1DRAFT_c0012241 | 3300000062 | Bacteria | 3939 |
| 23 | IMNBL1DRAFT_c0041516 | 3300000062 | Bacteria | 1543 |
| 24 | JGI24696J40584_12955165 | 3300002834 | Bacteria | 2778 |
| 25 | Ga0466735_046855 | 3300042624 | Bacteria | 10270 |
| 26 | Ga0466735_108707 | 3300042624 | Bacteria | 3424 |
| 27 | Ga0466730_079418 | 3300042625 | Bacteria | 679131 |
| 28 | Ga0466703_053508 | 3300042636 | Bacteria | 8515 |
| 29 | Ga0466703_378322 | 3300042636 | Bacteria | 3355 |
| 30 | Ga0466704_566564 | 3300042643 | Bacteria | 3062 |
| 31 | Ga0466727_121354 | 3300042655 | Bacteria | 12082 |
| 32 | Ga0466727_174137 | 3300042655 | Bacteria | 3924 |
| 33 | Ga0466701_096297 | 3300042598 | Bacteria | 103722 |
| 34 | Ga0466700_479075 | 3300042600 | Bacteria | 5522 |
| 35 | Ga0466722_073972 | 3300042609 | Bacteria | 128406 |
| 36 | Ga0123357_10124570 | 3300009784 | Bacteria | 3233 |
| 37 | Ga0123357_10472796 | 3300009784 | Unclassified | 1066 |
| 38 | Ga0123356_10014708 | 3300010049 | Bacteria | 7519 |
| 39 | Ga0123353_10474342 | 3300010167 | Bacteria | 1833 |
| 40 | Ga0123353_10930300 | 3300010167 | Bacteria | 1179 |
| 41 | Ga0466690_023696 | 3300042590 | Bacteria | 23811 |
| 42 | Ga0466692_079572 | 3300042591 | Bacteria | 5576 |
| 43 | Ga0466693_305320 | 3300042592 | Bacteria | 1404 |
| 44 | Ga0466712_278001 | 3300042614 | Bacteria | 1095 |
| 45 | Ga0466723_235111 | 3300042618 | Bacteria | 13674 |
| 46 | JGI24699J35502_11133587 | 3300002509 | Bacteria | 12286 |
| 47 | Ga0466704_009030 | 3300042643 | Bacteria | 11297 |
| 48 | Ga0466709_062466 | 3300042648 | Bacteria | 7409 |
| 49 | Ga0466709_318574 | 3300042648 | Bacteria | 87877 |
| 50 | Ga0466706_255935 | 3300042599 | Bacteria | 48242 |
| 51 | Ga0466707_161031 | 3300042601 | Bacteria | 6072 |
| 52 | Ga0466713_005558 | 3300042602 | Bacteria | 10134 |
| 53 | Ga0466716_527920 | 3300042605 | Bacteria | 23216 |
| 54 | Ga0466722_223624 | 3300042609 | Bacteria | 4492 |
| 55 | Ga0123357_10335039 | 3300009784 | Bacteria | 1472 |
| 56 | Ga0123354_10009800 | 3300010882 | Bacteria | 14720 |
| 57 | Ga0466657_070511 | 3300042582 | Bacteria | 1163 |
| 58 | Ga0466657_091532 | 3300042582 | Bacteria | 1218 |
| 59 | Ga0466691_051621 | 3300042593 | Bacteria | 8516 |
| 60 | Ga0466715_121550 | 3300042616 | Bacteria | 13380 |
| 61 | Ga0466726_034260 | 3300042619 | Bacteria | 7148 |
| 62 | Ga0466709_179340 | 3300042648 | Bacteria | 4079 |
| 63 | Ga0466725_030716 | 3300042654 | Bacteria | 28756 |
| 64 | Ga0466727_331077 | 3300042655 | Bacteria | 2521 |
| 65 | Ga0466705_381005 | 3300042612 | Bacteria | 5443 |
| 66 | Ga0466701_047597 | 3300042598 | Bacteria | 1845 |
| 67 | Ga0466706_084658 | 3300042599 | Bacteria | 6301 |
| 68 | Ga0466707_092068 | 3300042601 | Bacteria | 7028 |
| 69 | Ga0466716_165629 | 3300042605 | Bacteria | 14714 |
| 70 | Ga0466719_397365 | 3300042606 | Bacteria | 7417 |
| 71 | Ga0466722_188856 | 3300042609 | Bacteria | 3886 |
| 72 | Ga0466722_226889 | 3300042609 | Bacteria | 6161 |
| 73 | Ga0123357_10004340 | 3300009784 | Bacteria | 16620 |
| 74 | Ga0123357_10472794 | 3300009784 | Bacteria | 1066 |
| 75 | Ga0123356_10444375 | 3300010049 | Bacteria | 1444 |
| 76 | Ga0123353_10504804 | 3300010167 | Bacteria | 1761 |
| 77 | Ga0123353_10557465 | 3300010167 | Bacteria | 1651 |
| 78 | Ga0123354_10018506 | 3300010882 | Bacteria | 10922 |
| 79 | Ga0123354_10153021 | 3300010882 | Bacteria | 2783 |
| 80 | Ga0466690_244468 | 3300042590 | Bacteria | 30908 |
| 81 | Ga0466693_287481 | 3300042592 | Bacteria | 2847 |
| 82 | Ga0466696_224220 | 3300042596 | Bacteria | 4604 |
| 83 | Ga0466701_008116 | 3300042598 | Bacteria | 139371 |
| 84 | Ga0466710_228693 | 3300042613 | Bacteria | 1467 |
| 85 | Ga0466729_140456 | 3300042621 | Bacteria | 1903 |
| 86 | JGI24702J35022_10005414 | 3300002462 | Bacteria | 7470 |
| 87 | JGI24705J35276_12229772 | 3300002504 | Bacteria | 3462 |
| 88 | Ga0068302_10057170 | 3300005071 | Unclassified | 1078 |
| 89 | Ga0466730_046120 | 3300042625 | Bacteria | 1166 |
| 90 | Ga0466703_058308 | 3300042636 | Bacteria | 6245 |
| 91 | Ga0466703_222891 | 3300042636 | Bacteria | 9444 |
| 92 | Ga0466703_233292 | 3300042636 | Bacteria | 1451 |
| 93 | Ga0466709_176307 | 3300042648 | Bacteria | 46103 |
| 94 | Ga0466732_000584 | 3300042656 | Bacteria | 1452 |
| 95 | Ga0466707_059518 | 3300042601 | Bacteria | 3718 |
| 96 | Ga0466713_080540 | 3300042602 | Unclassified | 59038 |
| 97 | Ga0466719_495834 | 3300042606 | Bacteria | 4736 |
| 98 | Ga0466690_008835 | 3300042590 | Bacteria | 27085 |
| 99 | Ga0466692_137108 | 3300042591 | Bacteria | 7772 |
| 100 | Ga0466696_342708 | 3300042596 | Bacteria | 6300 |
| 101 | Ga0466711_143612 | 3300042615 | Bacteria | 3938 |
| 102 | Ga0466711_464373 | 3300042615 | Bacteria | 18405 |
| 103 | Ga0466715_291973 | 3300042616 | Bacteria | 6082 |
| 104 | HBC_ctgsDRAFT_1000006 | 3300000333 | Bacteria | 61367 |
| 105 | Ga0466729_273444 | 3300042621 | Bacteria | 8969 |
| 106 | Ga0466735_105036 | 3300042624 | Bacteria | 13392 |
| 107 | Ga0466704_237703 | 3300042643 | Bacteria | 2897 |
| 108 | Ga0466708_172342 | 3300042652 | Bacteria | 21087 |
| 109 | Ga0466727_008661 | 3300042655 | Bacteria | 5716 |
| 110 | Ga0466697_241565 | 3300042611 | Bacteria | 1315 |
| 111 | Ga0466700_106489 | 3300042600 | Bacteria | 2244 |
| 112 | Ga0466713_010652 | 3300042602 | Bacteria | 41319 |
| 113 | Ga0466716_541528 | 3300042605 | Bacteria | 12605 |
| 114 | Ga0123357_10153004 | 3300009784 | Bacteria | 2792 |
| 115 | Ga0123354_10015146 | 3300010882 | Bacteria | 12027 |
| 116 | Ga0466701_000974 | 3300042598 | Bacteria | 6469 |
| 117 | Ga0466715_122804 | 3300042616 | Bacteria | 8013 |
| 118 | Ga0466715_501308 | 3300042616 | Bacteria | 12254 |
| 119 | Ga0466729_014216 | 3300042621 | Unclassified | 7638 |
| 120 | 2227130795 | 2225789004 | Bacteria | 8982 |
| 121 | IMNBL1DRAFT_c0004210 | 3300000062 | Bacteria | 8739 |
| 122 | Ga0103264_1000008 | 3300007188 | Bacteria | 140843 |
| 123 | Ga0123357_10000367 | 3300009784 | Bacteria | 42582 |
| 124 | Ga0466704_115958 | 3300042643 | Bacteria | 4356 |
| 125 | Ga0466697_171347 | 3300042611 | Bacteria | 1106 |
| 126 | Ga0466705_157917 | 3300042612 | Bacteria | 7944 |
| 127 | Ga0466701_021952 | 3300042598 | Bacteria | 1791 |
| 128 | Ga0466701_035971 | 3300042598 | Bacteria | 18774 |
| 129 | Ga0466707_040792 | 3300042601 | Bacteria | 43826 |
| 130 | Ga0123354_10016391 | 3300010882 | Bacteria | 11613 |
| 131 | Ga0466656_237763 | 3300042550 | Bacteria | 1795 |
| 132 | Ga0466690_276484 | 3300042590 | Bacteria | 44393 |
| 133 | Ga0466692_151520 | 3300042591 | Bacteria | 33800 |
| 134 | Ga0466696_093250 | 3300042596 | Bacteria | 8978 |
| 135 | Ga0466726_231187 | 3300042619 | Bacteria | 1519 |
| 136 | Ga0466726_357022 | 3300042619 | Bacteria | 1452 |
| 137 | Ga0466728_051221 | 3300042620 | Bacteria | 8656 |
| 138 | JGI24702J35022_10000094 | 3300002462 | Bacteria | 40308 |
| 139 | Ga0102734_1000253 | 3300007129 | Bacteria | 16663 |
| 140 | Ga0466729_230338 | 3300042621 | Bacteria | 4287 |
| 141 | Ga0466735_076366 | 3300042624 | Bacteria | 3348 |
| 142 | Ga0466735_077776 | 3300042624 | Bacteria | 9115 |
| 143 | Ga0466724_69524 | 3300042649 | Bacteria | 891007 |
| 144 | Ga0466725_109433 | 3300042654 | Bacteria | 1358 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.