Protein Family IF02855

Metagenome Metatranscriptome Isolate
155 Members
54 Samples
140 Scaffolds
86.76 Avg Length

🧬 Representative Sequence

ID
3300010049|Ga0123356_10206339|Ga0123356_102063393
Length
89 aa
Sequence
MKIIWFEEAWEDYIYWQTQDKKTIKRINQLIQDSVRNGYSAGIGKPEPLKGEFGGFWSKRIDEVNRFVYRIREGCLEVLSCKGHYGDT*

📊 Sample Types

Isolate 9.0%
Metagenome 90.3%
MAG 0.0%
Metatranscriptome 0.7%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 44.2%
Unclassified 30.8%
Kalotermitidae 13.5%
Rhinotermitidae 3.8%
Termopsidae 3.8%
Hodotermitidae 1.9%
Passalidae 1.9%

🌳 Taxonomy

Archaea 0
Bacteria 144
Eukaryota 0
Viruses 1
Unclassified 10

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820405014 Unclassified Firmicutes Lab288P4bin88 Isolate Unclassified
2 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
3 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
4 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
5 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
6 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
7 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
8 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
9 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
10 2820265624 Unclassified Firmicutes Th196P3bin36 Isolate Unclassified
11 2820590132 Unclassified Firmicutes Emb289P1bin84 Isolate Unclassified
12 2820644600 Unclassified Firmicutes Cu122P5bin39 Isolate Unclassified
13 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
14 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
15 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
16 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
17 2820657860 Unclassified Firmicutes Co191P4bin15 Isolate Unclassified
18 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
19 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
20 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
21 2820350530 Unclassified Firmicutes Nt197P3bin37 Isolate Unclassified
22 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
23 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
24 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
25 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
26 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
27 2820171952 Unclassified Planctomycetes Th196P3bin88 Isolate Unclassified
28 2820249082 Unclassified Firmicutes Th196P3bin69 Isolate Unclassified
29 2820364642 Unclassified Firmicutes Nt197P3bin107 Isolate Unclassified
30 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
31 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
32 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
33 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
34 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
35 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
36 2820089333 Unclassified Proteobacteria Lab288P3bin88 Isolate Unclassified
37 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
38 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
39 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
40 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
41 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
42 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
43 3300021239 Termite gut microbial communities from nest from French Guiana - FG16_17_4 mRNA SA Metatranscriptome
44 2820647881 Unclassified Firmicutes Cu122P5bin16 Isolate Unclassified
45 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
46 2820005795 Unclassified Synergistetes Nt197P3bin106 Isolate Unclassified
47 2820246658 Unclassified Firmicutes Th196P3bin70 Isolate Unclassified
48 2820336130 Unclassified Firmicutes Nt197P3bin70 Isolate Unclassified
49 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
50 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
51 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
52 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
53 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
54 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_451256 3300042612 Bacteria 1490
2 Ga0466715_079906 3300042616 Bacteria 5044
3 Ga0466726_061470 3300042619 Bacteria 1589
4 Ga0123355_10961240 3300009826 Bacteria 915
5 Ga0123356_11957883 3300010049 Unclassified 730
6 Ga0123353_10000290 3300010167 Bacteria 62378
7 Ga0123353_10000952 3300010167 Bacteria 35375
8 Ga0123353_11009108 3300010167 Bacteria 1117
9 Ga0123353_11363786 3300010167 Bacteria 915
10 Ga0415639_021216 3300038395 Bacteria 2737
11 Ga0466714_002520 3300042603 Bacteria 2011
12 Ga0466714_160750 3300042603 Bacteria 1074
13 Ga0466717_114006 3300042604 Bacteria 24541
14 Ga0466717_126221 3300042604 Unclassified 2512
15 JGI24702J35022_10696891 3300002462 Bacteria 631
16 Ga0466733_159756 3300042659 Bacteria 3704
17 Ga0466726_474862 3300042619 Bacteria 2261
18 Ga0123355_10031111 3300009826 Bacteria 8658
19 Ga0123356_10206339 3300010049 Bacteria 2009
20 Ga0123356_10972648 3300010049 Bacteria 1019
21 Ga0123356_11176900 3300010049 Bacteria 933
22 Ga0123353_10052738 3300010167 Bacteria 6497
23 Ga0123353_11011421 3300010167 Bacteria 1115
24 Ga0415639_048157 3300038395 Unclassified 3173
25 Ga0415639_151711 3300038395 Bacteria 2724
26 Ga0466693_291707 3300042592 Bacteria 1194
27 JGI24702J35022_10160373 3300002462 Bacteria 1266
28 JGI24702J35022_10485486 3300002462 Bacteria 756
29 Ga0466734_002440 3300042623 Bacteria 8767
30 Ga0466703_291937 3300042636 Bacteria 1113
31 Ga0466704_358872 3300042643 Bacteria 3632
32 Ga0466704_532953 3300042643 Bacteria 3608
33 Ga0466726_037543 3300042619 Bacteria 1459
34 Ga0466728_288214 3300042620 Bacteria 1322
35 Ga0123355_10273364 3300009826 Bacteria 2344
36 Ga0123356_10165963 3300010049 Bacteria 2212
37 Ga0123356_10576440 3300010049 Bacteria 1288
38 Ga0123356_14078842 3300010049 Bacteria 503
39 Ga0123353_10230313 3300010167 Bacteria 2889
40 Ga0123353_10945222 3300010167 Bacteria 1167
41 Ga0123353_11233428 3300010167 Bacteria 978
42 Ga0123353_11316568 3300010167 Unclassified 936
43 Ga0123353_12045785 3300010167 Bacteria 699
44 Ga0123353_12211501 3300010167 Bacteria 665
45 Ga0123354_10829139 3300010882 Bacteria 618
46 Ga0415639_015998 3300038395 Bacteria 9744
47 Ga0466657_114982 3300042582 Bacteria 3132
48 Ga0466719_188835 3300042606 Bacteria 1465
49 Ga0068305_10042825 3300005083 Bacteria 841
50 Ga0466704_009421 3300042643 Bacteria 1284
51 Ga0466704_016217 3300042643 Bacteria 3526
52 Ga0466733_038474 3300042659 Bacteria 4667
53 Ga0466712_015715 3300042614 Bacteria 1500
54 Ga0466715_093228 3300042616 Bacteria 4322
55 Ga0123357_10777620 3300009784 Bacteria 656
56 Ga0123355_10206614 3300009826 Bacteria 2856
57 Ga0123356_10903144 3300010049 Bacteria 1054
58 Ga0123356_12605734 3300010049 Bacteria 633
59 Ga0123353_10005078 3300010167 Bacteria 17177
60 Ga0123353_10361066 3300010167 Bacteria 2183
61 Ga0123353_10458393 3300010167 Unclassified 1874
62 Ga0123353_10683021 3300010167 Bacteria 1445
63 Ga0123353_11415356 3300010167 Bacteria 893
64 Ga0123353_11821071 3300010167 Bacteria 755
65 Ga0123353_12253695 3300010167 Bacteria 657
66 Ga0123354_10617750 3300010882 Bacteria 787
67 Ga0415639_259673 3300038395 Bacteria 944
68 Ga0466707_090070 3300042601 Bacteria 1246
69 Ga0466707_329087 3300042601 Bacteria 2714
70 Ga0466721_009841 3300042608 Bacteria 1450
71 Ga0466722_086690 3300042609 Bacteria 1369
72 JGI24705J35276_12219503 3300002504 Bacteria 2208
73 JGI24696J40584_12733667 3300002834 Bacteria 773
74 Ga0072941_1537075 3300005201 Bacteria 557
75 Ga0466733_080042 3300042659 Bacteria 2627
76 Ga0123355_10434296 3300009826 Unclassified 1668
77 Ga0123356_10318251 3300010049 Bacteria 1668
78 Ga0123353_10536165 3300010167 Bacteria 1693
79 Ga0466717_242890 3300042604 Bacteria 5272
80 Ga0466698_220940 3300042610 Bacteria 1730
81 JGI24702J35022_10244242 3300002462 Bacteria 1042
82 Ga0466702_283222 3300042635 Bacteria 1241
83 Ga0466703_302346 3300042636 Bacteria 4056
84 Ga0123355_10097927 3300009826 Bacteria 4627
85 Ga0123355_12076687 3300009826 Bacteria 524
86 Ga0123356_11486029 3300010049 Bacteria 835
87 Ga0123356_11933532 3300010049 Bacteria 735
88 Ga0123356_12423430 3300010049 Bacteria 657
89 Ga0123356_13605868 3300010049 Unclassified 536
90 Ga0123353_10218347 3300010167 Bacteria 2984
91 Ga0123353_10381389 3300010167 Bacteria 2108
92 Ga0123353_12886108 3300010167 Bacteria 560
93 Ga0123354_10056373 3300010882 Bacteria 5868
94 Ga0223677_1005392 3300021239 Bacteria 789
95 Ga0415639_184006 3300038395 Bacteria 1111
96 Ga0466714_142506 3300042603 Bacteria 1344
97 Ga0466717_313936 3300042604 Bacteria 2007
98 JGI24702J35022_10063101 3300002462 Bacteria 1985
99 JGI24705J35276_12179035 3300002504 Bacteria 1352
100 Ga0072941_1678446 3300005201 Bacteria 697
101 Ga0466734_086299 3300042623 Bacteria 1650
102 Ga0466703_042137 3300042636 Bacteria 3149
103 Ga0466727_083753 3300042655 Bacteria 1135
104 Ga0466733_212595 3300042659 Bacteria 4423
105 Ga0466718_031112 3300042617 Bacteria 3497
106 Ga0466726_400214 3300042619 Bacteria 9380
107 Ga0123357_10520422 3300009784 Unclassified 972
108 Ga0123355_10588157 3300009826 Bacteria 1327
109 Ga0123356_10366263 3300010049 Bacteria 1570
110 Ga0123356_13088083 3300010049 Bacteria 581
111 Ga0123356_13455017 3300010049 Bacteria 548
112 Ga0123353_11787717 3300010167 Bacteria 765
113 Ga0123354_10823974 3300010882 Bacteria 621
114 Ga0466706_088624 3300042599 Bacteria 56905
115 Ga0466700_197163 3300042600 Bacteria 1207
116 Ga0466700_482451 3300042600 Bacteria 1390
117 Ga0466717_057358 3300042604 Bacteria 1019
118 Ga0466721_294271 3300042608 Bacteria 1021
119 IMNBL1DRAFT_c0026990 3300000062 Bacteria 2170
120 Ga0068305_10001129 3300005083 Viruses 3845
121 Ga0466729_230217 3300042621 Bacteria 1876
122 Ga0466734_142081 3300042623 Bacteria 1637
123 Ga0123355_10996431 3300009826 Bacteria 891
124 Ga0123356_10410556 3300010049 Bacteria 1494
125 Ga0123356_10688686 3300010049 Bacteria 1191
126 Ga0123353_10316703 3300010167 Bacteria 2370
127 Ga0123353_10373638 3300010167 Bacteria 2136
128 Ga0123353_11181982 3300010167 Bacteria 1006
129 Ga0123353_11198058 3300010167 Bacteria 997
130 Ga0123353_11823873 3300010167 Bacteria 755
131 Ga0123353_12166829 3300010167 Unclassified 674
132 Ga0123354_10412725 3300010882 Bacteria 1130
133 Ga0415639_071539 3300038395 Bacteria 1016
134 Ga0466657_215708 3300042582 Bacteria 1263
135 Ga0466690_075262 3300042590 Bacteria 1114
136 Ga0466693_386087 3300042592 Bacteria 3734
137 Ga0466699_046781 3300042597 Bacteria 3096
138 Ga0466700_407827 3300042600 Bacteria 1905
139 JGI24703J35330_11569591 3300002501 Bacteria 1277
140 JGI24696J40584_12959821 3300002834 Bacteria 5713

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042643 Ga0466704_358872 Ga0466704_358872_3366_3593 75
2 iso_pr_bacteria 2820089333 2820090411 75
3 3300010167 Ga0123353_10005078 Ga0123353_1000507816 76
4 iso_pr_bacteria 2820171952 2820174851 76
5 iso_pr_bacteria 2820350530 2820351959 78
6 3300010167 Ga0123353_10381389 Ga0123353_103813893 79
7 3300010167 Ga0123353_10000290 Ga0123353_1000029021 84
8 3300042655 Ga0466727_083753 Ga0466727_083753_628_882 84
9 3300010882 Ga0123354_10829139 Ga0123354_108291391 85
10 3300038395 Ga0415639_048157 Ga0415639_048157_237_494 85
11 3300042610 Ga0466698_220940 Ga0466698_220940_587_844 85
12 iso_pr_bacteria 2820265624 2820267492 85
13 iso_pr_bacteria 2820590132 2820591160 85
14 iso_pr_bacteria 2820647881 2820648609 85
15 3300002501 JGI24703J35330_11569591 JGI24703J35330_115695912 86
16 3300009826 Ga0123355_10031111 Ga0123355_1003111111 86
17 3300009826 Ga0123355_10206614 Ga0123355_102066141 86
18 3300009826 Ga0123355_10273364 Ga0123355_102733642 86
19 3300009826 Ga0123355_10434296 Ga0123355_104342963 86
20 3300010167 Ga0123353_10683021 Ga0123353_106830211 86
21 3300010167 Ga0123353_11316568 Ga0123353_113165683 86
22 3300010167 Ga0123353_11823873 Ga0123353_118238732 86
23 3300021239 Ga0223677_1005392 Ga0223677_10053922 86
24 3300038395 Ga0415639_071539 Ga0415639_071539_738_998 86
25 3300038395 Ga0415639_151711 Ga0415639_151711_1093_1353 86
26 3300038395 Ga0415639_259673 Ga0415639_259673_284_544 86
27 3300042582 Ga0466657_215708 Ga0466657_215708_305_565 86
28 3300042592 Ga0466693_291707 Ga0466693_291707_171_431 86
29 3300042600 Ga0466700_197163 Ga0466700_197163_155_415 86
30 3300042603 Ga0466714_142506 Ga0466714_142506_169_429 86
31 3300042603 Ga0466714_160750 Ga0466714_160750_454_714 86
32 3300042604 Ga0466717_126221 Ga0466717_126221_1185_1445 86
33 3300042604 Ga0466717_242890 Ga0466717_242890_4685_4945 86
34 3300042608 Ga0466721_009841 Ga0466721_009841_941_1201 86
35 3300042609 Ga0466722_086690 Ga0466722_086690_344_604 86
36 3300042620 Ga0466728_288214 Ga0466728_288214_635_895 86
37 3300042621 Ga0466729_230217 Ga0466729_230217_406_666 86
38 3300042623 Ga0466734_002440 Ga0466734_002440_1602_1862 86
39 3300042623 Ga0466734_086299 Ga0466734_086299_706_966 86
40 3300042623 Ga0466734_142081 Ga0466734_142081_1272_1532 86
41 3300042636 Ga0466703_042137 Ga0466703_042137_1752_2012 86
42 3300042636 Ga0466703_291937 Ga0466703_291937_524_784 86
43 3300042636 Ga0466703_302346 Ga0466703_302346_3545_3805 86
44 3300042643 Ga0466704_016217 Ga0466704_016217_2709_2969 86
45 3300042659 Ga0466733_159756 Ga0466733_159756_1814_2074 86
46 3300042659 Ga0466733_212595 Ga0466733_212595_871_1131 86
47 iso_pr_bacteria 2820005795 2820006465 86
48 iso_pr_bacteria 2820246658 2820247817 86
49 iso_pr_bacteria 2820405014 2820406157 86
50 iso_pr_bacteria 2820657860 2820659351 86
51 3300002462 JGI24702J35022_10063101 JGI24702J35022_100631013 87
52 3300002462 JGI24702J35022_10160373 JGI24702J35022_101603731 87
53 3300002462 JGI24702J35022_10244242 JGI24702J35022_102442422 87
54 3300002462 JGI24702J35022_10485486 JGI24702J35022_104854861 87
55 3300002462 JGI24702J35022_10696891 JGI24702J35022_106968912 87
56 3300002504 JGI24705J35276_12179035 JGI24705J35276_121790351 87
57 3300002834 JGI24696J40584_12959821 JGI24696J40584_129598215 87
58 3300005083 Ga0068305_10001129 Ga0068305_100011293 87
59 3300005201 Ga0072941_1678446 Ga0072941_16784461 87
60 3300009784 Ga0123357_10520422 Ga0123357_105204223 87
61 3300009826 Ga0123355_10097927 Ga0123355_100979275 87
62 3300009826 Ga0123355_10588157 Ga0123355_105881573 87
63 3300009826 Ga0123355_12076687 Ga0123355_120766871 87
64 3300010049 Ga0123356_10165963 Ga0123356_101659633 87
65 3300010049 Ga0123356_10366263 Ga0123356_103662633 87
66 3300010049 Ga0123356_10410556 Ga0123356_104105563 87
67 3300010049 Ga0123356_10688686 Ga0123356_106886862 87
68 3300010049 Ga0123356_11486029 Ga0123356_114860292 87
69 3300010049 Ga0123356_11933532 Ga0123356_119335322 87
70 3300010049 Ga0123356_13455017 Ga0123356_134550172 87
71 3300010049 Ga0123356_14078842 Ga0123356_140788421 87
72 3300010167 Ga0123353_10052738 Ga0123353_100527387 87
73 3300010167 Ga0123353_10218347 Ga0123353_102183474 87
74 3300010167 Ga0123353_10230313 Ga0123353_102303133 87
75 3300010167 Ga0123353_10316703 Ga0123353_103167032 87
76 3300010167 Ga0123353_10361066 Ga0123353_103610663 87
77 3300010167 Ga0123353_10373638 Ga0123353_103736382 87
78 3300010167 Ga0123353_11011421 Ga0123353_110114211 87
79 3300010167 Ga0123353_11181982 Ga0123353_111819822 87
80 3300010167 Ga0123353_11233428 Ga0123353_112334282 87
81 3300010167 Ga0123353_11415356 Ga0123353_114153562 87
82 3300010167 Ga0123353_11821071 Ga0123353_118210711 87
83 3300010167 Ga0123353_12253695 Ga0123353_122536952 87
84 3300010167 Ga0123353_12886108 Ga0123353_128861082 87
85 3300010167 Ga0123353_12886108 Ga0123353_128861082 87
86 3300010882 Ga0123354_10056373 Ga0123354_100563734 87
87 3300010882 Ga0123354_10617750 Ga0123354_106177502 87
88 3300010882 Ga0123354_10823974 Ga0123354_108239741 87
89 3300042582 Ga0466657_114982 Ga0466657_114982_1037_1300 87
90 3300042590 Ga0466690_075262 Ga0466690_075262_148_411 87
91 3300042592 Ga0466693_386087 Ga0466693_386087_2648_2911 87
92 3300042597 Ga0466699_046781 Ga0466699_046781_2586_2849 87
93 3300042599 Ga0466706_088624 Ga0466706_088624_50304_50567 87
94 3300042600 Ga0466700_407827 Ga0466700_407827_174_437 87
95 3300042600 Ga0466700_482451 Ga0466700_482451_766_1029 87
96 3300042601 Ga0466707_090070 Ga0466707_090070_544_807 87
97 3300042601 Ga0466707_329087 Ga0466707_329087_503_766 87
98 3300042604 Ga0466717_114006 Ga0466717_114006_8224_8487 87
99 3300042608 Ga0466721_294271 Ga0466721_294271_498_761 87
100 3300042612 Ga0466705_451256 Ga0466705_451256_886_1149 87
101 3300042614 Ga0466712_015715 Ga0466712_015715_963_1226 87
102 3300042616 Ga0466715_079906 Ga0466715_079906_3809_4072 87
103 3300042616 Ga0466715_093228 Ga0466715_093228_315_578 87
104 3300042617 Ga0466718_031112 Ga0466718_031112_2791_3054 87
105 3300042619 Ga0466726_037543 Ga0466726_037543_597_860 87
106 3300042619 Ga0466726_061470 Ga0466726_061470_347_610 87
107 3300042643 Ga0466704_009421 Ga0466704_009421_852_1115 87
108 3300042643 Ga0466704_532953 Ga0466704_532953_2049_2312 87
109 3300042659 Ga0466733_038474 Ga0466733_038474_1485_1748 87
110 3300042659 Ga0466733_080042 Ga0466733_080042_2180_2443 87
111 iso_pr_bacteria 2820249082 2820249802 87
112 iso_pr_bacteria 2820364642 2820365800 87
113 iso_pr_bacteria 2820644600 2820644660 87
114 3300000062 IMNBL1DRAFT_c0026990 IMNBL1DRAFT_00269902 88
115 3300002504 JGI24705J35276_12219503 JGI24705J35276_122195033 88
116 3300002834 JGI24696J40584_12733667 JGI24696J40584_127336672 88
117 3300005083 Ga0068305_10042825 Ga0068305_100428251 88
118 3300005201 Ga0072941_1537075 Ga0072941_15370751 88
119 3300009826 Ga0123355_10961240 Ga0123355_109612402 88
120 3300009826 Ga0123355_10996431 Ga0123355_109964312 88
121 3300010049 Ga0123356_10318251 Ga0123356_103182513 88
122 3300010049 Ga0123356_10903144 Ga0123356_109031441 88
123 3300010049 Ga0123356_10972648 Ga0123356_109726482 88
124 3300010049 Ga0123356_11176900 Ga0123356_111769003 88
125 3300010049 Ga0123356_12605734 Ga0123356_126057342 88
126 3300010049 Ga0123356_13605868 Ga0123356_136058682 88
127 3300010167 Ga0123353_10000952 Ga0123353_100009526 88
128 3300010167 Ga0123353_10458393 Ga0123353_104583932 88
129 3300010167 Ga0123353_10945222 Ga0123353_109452222 88
130 3300010167 Ga0123353_11009108 Ga0123353_110091081 88
131 3300010167 Ga0123353_11198058 Ga0123353_111980582 88
132 3300010167 Ga0123353_11363786 Ga0123353_113637862 88
133 3300010167 Ga0123353_11787717 Ga0123353_117877171 88
134 3300010167 Ga0123353_12045785 Ga0123353_120457852 88
135 3300010167 Ga0123353_12166829 Ga0123353_121668292 88
136 3300010882 Ga0123354_10412725 Ga0123354_104127252 88
137 3300038395 Ga0415639_015998 Ga0415639_015998_8480_8746 88
138 3300042604 Ga0466717_313936 Ga0466717_313936_163_429 88
139 3300042619 Ga0466726_400214 Ga0466726_400214_5524_5790 88
140 3300042619 Ga0466726_474862 Ga0466726_474862_338_604 88
141 3300042635 Ga0466702_283222 Ga0466702_283222_94_360 88
142 3300010049 Ga0123356_10206339 Ga0123356_102063393 89
143 3300010049 Ga0123356_10576440 Ga0123356_105764401 89
144 3300010049 Ga0123356_11957883 Ga0123356_119578833 89
145 3300010049 Ga0123356_12423430 Ga0123356_124234302 89
146 3300010167 Ga0123353_12211501 Ga0123353_122115011 89
147 3300038395 Ga0415639_184006 Ga0415639_184006_87_356 89
148 3300009784 Ga0123357_10777620 Ga0123357_107776202 90
149 3300042604 Ga0466717_057358 Ga0466717_057358_459_731 90
150 iso_pr_bacteria 2820336130 2820337905 90
151 3300038395 Ga0415639_021216 Ga0415639_021216_1675_1950 91
152 3300042606 Ga0466719_188835 Ga0466719_188835_290_571 93
153 3300010049 Ga0123356_13088083 Ga0123356_130880832 94
154 3300010167 Ga0123353_10536165 Ga0123353_105361652 94
155 3300042603 Ga0466714_002520 Ga0466714_002520_1550_1834 94

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF06769 YoeB_toxin YoeB-like toxin of bacterial type II toxin-antitoxin system 5 85 0.97

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.82 0.82 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.