Protein Family IF02851

Metagenome Isolate
157 Members
47 Samples
142 Scaffolds
300.1 Avg Length

🧬 Representative Sequence

ID
3300010049|Ga0123356_10198957|Ga0123356_101989572
Length
333 aa
Sequence
MPCFSFLLNMVLRGSYCRVNLKIVKNLAKLALFFSLTFIIIFVTVTCLRFLSLRIEWAKSLPPKPETTLTLILAAAHWALSLTLFSSILLTLNYVVRRHHFALVSIICVMALSFALCFGISFVLEQWKSVPPAQTAGIQLGEKGVILSNSLNRNVTAVVLLEGVANPLGPRVTAIPGQPLVFHEATGANFERTMFALPPVPFGDDTPWFLKSLAIDIRLNAEMLQRKFSEGFFPYLIYAGSFIFLLCALGYAIKFSVWPLANLFLAMLAFRGILALGSFANTPEMQELINSFLNNIIPVMLALPLFFLGIGVLVHFYSFLTFIARRRDDDDF*

📊 Sample Types

Isolate 9.6%
Metagenome 90.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 44.4%
Unclassified 35.6%
Rhinotermitidae 8.9%
Kalotermitidae 6.7%
Termopsidae 4.4%

🌳 Taxonomy

Archaea 0
Bacteria 141
Eukaryota 0
Viruses 0
Unclassified 16

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
2 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
3 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
4 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
5 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
6 2781125656 Treponema sp. Emb289P1bin65 Isolate Unclassified
7 2781125663 Treponema sp. Emb289P3bin135 Isolate Unclassified
8 2781125665 Treponema sp. Emb289P3bin117 Isolate Unclassified
9 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
10 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
11 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
12 2781125650 Treponema sp. Co191P3bin64 Isolate Unclassified
13 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
14 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
15 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
16 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
17 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
18 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
19 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
20 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
21 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
22 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
23 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
24 2781125636 Treponema sp. Co191P1bin67 Isolate Unclassified
25 2781125662 Treponema sp. Emb289P3bin141 Isolate Unclassified
26 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified
27 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
28 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
29 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
30 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
31 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
32 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
33 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
34 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
35 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
36 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
37 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
38 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
39 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
40 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
41 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
42 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
43 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
44 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
45 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
46 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
47 3300005200 Nasutitermes gut metagenome Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_395551 3300042656 Bacteria 26916
2 Ga0123356_10000044 3300010049 Bacteria 132964
3 Ga0123356_10000426 3300010049 Bacteria 48138
4 Ga0123356_10000943 3300010049 Bacteria 32172
5 Ga0123356_10198957 3300010049 Bacteria 2042
6 Ga0466707_378453 3300042601 Bacteria 4255
7 Ga0466720_034419 3300042607 Bacteria 11516
8 Ga0466693_319496 3300042592 Bacteria 7079
9 Ga0466735_222605 3300042624 Bacteria 1465
10 Ga0466702_463789 3300042635 Bacteria 14167
11 AustNasuHG_c1006211 3300000089 Bacteria 4271
12 JGI24698J34947_10009234 3300002449 Bacteria 5409
13 JGI24695J34938_10000707 3300002450 Bacteria 31446
14 JGI24695J34938_10006311 3300002450 Bacteria 7170
15 JGI24695J34938_10009268 3300002450 Bacteria 5487
16 JGI24695J34938_10025282 3300002450 Bacteria 2840
17 JGI24695J34938_10028981 3300002450 Unclassified 2593
18 Ga0072940_1139421 3300005200 Unclassified 1679
19 Ga0466732_092555 3300042656 Bacteria 15631
20 Ga0123356_10000295 3300010049 Bacteria 57433
21 Ga0123356_10016687 3300010049 Bacteria 7003
22 Ga0123356_10061859 3300010049 Bacteria 3496
23 Ga0123356_10092723 3300010049 Bacteria 2881
24 Ga0123356_10526667 3300010049 Bacteria 1341
25 Ga0466707_028179 3300042601 Bacteria 1710
26 Ga0264413_109056 3300024493 Bacteria 6573
27 Ga0415639_122054 3300038395 Bacteria 5442
28 Ga0466699_072196 3300042597 Bacteria 50938
29 Ga0466702_093390 3300042635 Unclassified 1258
30 Ga0466702_365724 3300042635 Bacteria 2937
31 JGI24698J34947_10000078 3300002449 Bacteria 31619
32 JGI24698J34947_10002217 3300002449 Bacteria 10410
33 JGI24695J34938_10005002 3300002450 Bacteria 8441
34 JGI24695J34938_10007407 3300002450 Bacteria 6427
35 JGI24695J34938_10059142 3300002450 Bacteria 1641
36 JGI24695J34938_10075785 3300002450 Unclassified 1397
37 Ga0072941_1027603 3300005201 Bacteria 6963
38 Ga0072941_1030507 3300005201 Bacteria 7261
39 Ga0072941_1163556 3300005201 Bacteria 1278
40 Ga0466712_023804 3300042614 Bacteria 31613
41 Ga0466712_090145 3300042614 Bacteria 11614
42 Ga0466712_149563 3300042614 Bacteria 12473
43 Ga0123356_10004228 3300010049 Bacteria 14850
44 Ga0123356_10300353 3300010049 Bacteria 1710
45 Ga0466707_111927 3300042601 Bacteria 1333
46 Ga0264413_105193 3300024493 Bacteria 48930
47 Ga0466693_128816 3300042592 Bacteria 39215
48 Ga0466694_221922 3300042594 Bacteria 39680
49 JGI24698J34947_10000049 3300002449 Bacteria 34934
50 JGI24695J34938_10001109 3300002450 Bacteria 24296
51 JGI24695J34938_10001141 3300002450 Bacteria 23755
52 JGI24695J34938_10003615 3300002450 Bacteria 10622
53 JGI24695J34938_10004706 3300002450 Bacteria 8834
54 Ga0072941_1020136 3300005201 Bacteria 17867
55 Ga0466712_146868 3300042614 Bacteria 1586
56 Ga0466712_279712 3300042614 Bacteria 4466
57 Ga0466719_480983 3300042606 Bacteria 34203
58 Ga0466720_040535 3300042607 Unclassified 7360
59 Ga0264413_109809 3300024493 Bacteria 6828
60 Ga0264413_129497 3300024493 Bacteria 3338
61 Ga0415639_069674 3300038395 Bacteria 4518
62 Ga0415639_114931 3300038395 Bacteria 3448
63 Ga0466692_041378 3300042591 Bacteria 12137
64 Ga0466694_135857 3300042594 Bacteria 8701
65 Ga0466699_070361 3300042597 Bacteria 22948
66 Ga0466699_138057 3300042597 Bacteria 3976
67 Ga0466699_421101 3300042597 Bacteria 1306
68 Ga0466731_269012 3300042622 Bacteria 4551
69 Ga0466703_214705 3300042636 Bacteria 7615
70 JGI24695J34938_10000440 3300002450 Bacteria 40101
71 Ga0074263_102052 3300005485 Unclassified 883
72 Ga0466705_442434 3300042612 Bacteria 5633
73 Ga0466712_147932 3300042614 Bacteria 29015
74 Ga0466712_154279 3300042614 Bacteria 5315
75 Ga0466718_042439 3300042617 Bacteria 2465
76 Ga0466718_092664 3300042617 Bacteria 3915
77 Ga0466718_137265 3300042617 Unclassified 1271
78 Ga0466729_097040 3300042621 Bacteria 1048
79 Ga0123356_10003862 3300010049 Bacteria 15609
80 Ga0123356_10238874 3300010049 Unclassified 1886
81 Ga0123356_10331080 3300010049 Bacteria 1640
82 Ga0123356_10350415 3300010049 Bacteria 1600
83 Ga0123356_10394309 3300010049 Unclassified 1520
84 Ga0123353_10904548 3300010167 Unclassified 1201
85 Ga0466721_091276 3300042608 Bacteria 1548
86 Ga0456237_0008362 3300041968 Bacteria 1565
87 Ga0466729_283512 3300042621 Bacteria 2033
88 Ga0466731_164025 3300042622 Bacteria 7111
89 Ga0466731_180449 3300042622 Bacteria 2480
90 JGI24698J34947_10042698 3300002449 Unclassified 2328
91 JGI24695J34938_10005751 3300002450 Bacteria 7638
92 Ga0072941_1004709 3300005201 Bacteria 7666
93 Ga0072941_1037811 3300005201 Bacteria 8861
94 Ga0466712_130926 3300042614 Bacteria 31676
95 Ga0466718_114609 3300042617 Unclassified 1502
96 Ga0466718_137268 3300042617 Bacteria 2784
97 Ga0466726_185128 3300042619 Bacteria 2315
98 Ga0123355_10118735 3300009826 Bacteria 4108
99 Ga0123356_10000415 3300010049 Bacteria 48650
100 Ga0123356_10004764 3300010049 Unclassified 13959
101 Ga0123356_10014219 3300010049 Bacteria 7657
102 Ga0123356_10032780 3300010049 Bacteria 4858
103 Ga0123353_10054055 3300010167 Bacteria 6420
104 Ga0466700_021829 3300042600 Bacteria 3928
105 Ga0466719_470679 3300042606 Bacteria 7732
106 Ga0466720_233754 3300042607 Bacteria 3823
107 Ga0415639_165506 3300038395 Bacteria 4145
108 Ga0466694_015330 3300042594 Bacteria 2897
109 Ga0466694_090848 3300042594 Bacteria 14965
110 Ga0466694_099331 3300042594 Bacteria 8867
111 Ga0466699_233152 3300042597 Bacteria 3617
112 JGI24695J34938_10000581 3300002450 Bacteria 35281
113 JGI24695J34938_10003147 3300002450 Unclassified 11750
114 Ga0072941_1004710 3300005201 Bacteria 7567
115 Ga0072941_1004812 3300005201 Bacteria 10055
116 Ga0072941_1054877 3300005201 Bacteria 2091
117 Ga0466732_334212 3300042656 Bacteria 5685
118 Ga0466712_162461 3300042614 Bacteria 25933
119 Ga0466712_321595 3300042614 Bacteria 2160
120 Ga0466718_131998 3300042617 Unclassified 1625
121 Ga0466720_178182 3300042607 Bacteria 14380
122 Ga0466702_039024 3300042635 Bacteria 10412
123 Ga0466702_238419 3300042635 Bacteria 4568
124 JGI24698J34947_10007415 3300002449 Bacteria 6031
125 JGI24695J34938_10000138 3300002450 Bacteria 66191
126 JGI24695J34938_10000445 3300002450 Bacteria 39971
127 JGI24695J34938_10053722 3300002450 Bacteria 1751
128 Ga0072941_1018625 3300005201 Bacteria 6103
129 Ga0072941_1096763 3300005201 Bacteria 5146
130 Ga0466712_048853 3300042614 Bacteria 7900
131 Ga0466712_063991 3300042614 Bacteria 24908
132 Ga0466712_318646 3300042614 Bacteria 14434
133 Ga0466718_051458 3300042617 Unclassified 1630
134 Ga0466718_111430 3300042617 Bacteria 3494
135 Ga0466718_131775 3300042617 Bacteria 2217
136 Ga0466722_189967 3300042609 Bacteria 4830
137 Ga0466694_138538 3300042594 Bacteria 2498
138 Ga0466699_025341 3300042597 Bacteria 1454
139 AustNasuHG_c1000178 3300000089 Bacteria 20659
140 JGI24698J34947_10021771 3300002449 Bacteria 3445
141 JGI24695J34938_10000064 3300002450 Bacteria 87537
142 JGI24695J34938_10000769 3300002450 Bacteria 29994

🧩 MSA Aligner

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.