Protein Family IF02806
Metagenome
Isolate
133
Members
45
Samples
128
Scaffolds
104.06
Avg Length
Representative Sequence
- ID
- 3300010049|Ga0123356_10109749|Ga0123356_101097493
- Length
- 124 aa
- Sequence
- MKFKKQLKFGQNISIKKQQQMKAYTLDEVQDKLIGKIGTPDRDLFEYELQMDLIGKAIKQTRQERNLTQEELGKLIGVQKAQISRLENNTSNVTMVTLLRVFTALKAKIKLQVELPNVNVSLG*
Sample Types
Isolate
3.8%
Metagenome
96.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
53.3%
Unclassified
13.3%
Kalotermitidae
11.1%
Passalidae
6.7%
Termopsidae
6.7%
Culicidae
2.2%
Armadillidiidae
2.2%
Rhinotermitidae
2.2%
Drosophilidae
2.2%
Taxonomy
Archaea
0
Bacteria
102
Eukaryota
0
Viruses
0
Unclassified
31
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820651690 | Unclassified Firmicutes Cu122P3bin6 | Isolate | Unclassified |
| 2 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 3 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 4 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 5 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 6 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 7 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 8 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 9 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 10 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 11 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 12 | 2820741847 | Unclassified Bacteroidetes Th196P3bin71 | Isolate | Unclassified |
| 13 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 14 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 15 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 16 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 17 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 18 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 19 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 20 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 21 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 22 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 23 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 24 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 25 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 26 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 27 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 28 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 29 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 30 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 31 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 32 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 33 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 34 | 2820797595 | Unclassified Bacteroidetes Co191P3bin3 | Isolate | Unclassified |
| 35 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 36 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 37 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 38 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 39 | 3300007507 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 4 gut | Metagenome | Drosophilidae |
| 40 | 2820765201 | Unclassified Bacteroidetes Lab288P3bin82 | Isolate | Unclassified |
| 41 | 2820789850 | Unclassified Bacteroidetes Cu122P3bin3 | Isolate | Unclassified |
| 42 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 43 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 44 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 45 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466710_111256 | 3300042613 | Bacteria | 1898 |
| 2 | 2227519924 | 2225789004 | Unclassified | 3361 |
| 3 | 2227605164 | 2225789004 | Bacteria | 12380 |
| 4 | IMNBL1DRAFT_c0014483 | 3300000062 | Bacteria | 3478 |
| 5 | IMNBL1DRAFT_c0054487 | 3300000062 | Bacteria | 1238 |
| 6 | JGI24705J35276_11564046 | 3300002504 | Bacteria | 578 |
| 7 | Ga0123353_11482339 | 3300010167 | Bacteria | 866 |
| 8 | Ga0466657_278730 | 3300042582 | Bacteria | 2287 |
| 9 | Ga0466690_035613 | 3300042590 | Unclassified | 5674 |
| 10 | Ga0466694_380095 | 3300042594 | Bacteria | 1303 |
| 11 | Ga0466699_187484 | 3300042597 | Bacteria | 1160 |
| 12 | Ga0466701_057738 | 3300042598 | Bacteria | 1695 |
| 13 | Ga0466729_206460 | 3300042621 | Bacteria | 1160 |
| 14 | Ga0466709_043494 | 3300042648 | Unclassified | 1661 |
| 15 | Ga0466725_062615 | 3300042654 | Bacteria | 1212 |
| 16 | Ga0466727_159417 | 3300042655 | Bacteria | 6226 |
| 17 | Ga0466697_171191 | 3300042611 | Bacteria | 1209 |
| 18 | Ga0466710_049839 | 3300042613 | Unclassified | 1104 |
| 19 | Ga0466710_079760 | 3300042613 | Bacteria | 1042 |
| 20 | Ga0466726_167395 | 3300042619 | Bacteria | 2452 |
| 21 | IMNBL1DRAFT_c0060810 | 3300000062 | Bacteria | 1137 |
| 22 | JGI24702J35022_10129654 | 3300002462 | Bacteria | 1399 |
| 23 | JGI24702J35022_10660330 | 3300002462 | Bacteria | 649 |
| 24 | Ga0105008_1117411 | 3300007507 | Unclassified | 3346 |
| 25 | Ga0123355_10534619 | 3300009826 | Bacteria | 1426 |
| 26 | Ga0123356_10427659 | 3300010049 | Bacteria | 1468 |
| 27 | Ga0123356_12640723 | 3300010049 | Unclassified | 629 |
| 28 | Ga0123356_13217317 | 3300010049 | Unclassified | 568 |
| 29 | Ga0123356_14125330 | 3300010049 | Unclassified | 500 |
| 30 | Ga0123353_10109673 | 3300010167 | Bacteria | 4446 |
| 31 | Ga0123353_10771255 | 3300010167 | Unclassified | 1334 |
| 32 | Ga0123353_11172000 | 3300010167 | Bacteria | 1012 |
| 33 | Ga0123354_10013157 | 3300010882 | Bacteria | 12833 |
| 34 | Ga0123354_10028982 | 3300010882 | Bacteria | 8715 |
| 35 | Ga0466656_188363 | 3300042550 | Bacteria | 2321 |
| 36 | Ga0466656_350463 | 3300042550 | Bacteria | 1217 |
| 37 | Ga0466701_045216 | 3300042598 | Bacteria | 2552 |
| 38 | Ga0466735_080930 | 3300042624 | Bacteria | 2084 |
| 39 | Ga0466704_043105 | 3300042643 | Unclassified | 1569 |
| 40 | IMNBL1DRAFT_c0013702 | 3300000062 | Bacteria | 3615 |
| 41 | JGI24702J35022_10105828 | 3300002462 | Bacteria | 1544 |
| 42 | Ga0123357_10265835 | 3300009784 | Bacteria | 1803 |
| 43 | Ga0123356_11258556 | 3300010049 | Bacteria | 904 |
| 44 | Ga0123354_10657780 | 3300010882 | Bacteria | 746 |
| 45 | Ga0466657_137608 | 3300042582 | Bacteria | 4731 |
| 46 | Ga0466698_058322 | 3300042610 | Bacteria | 1095 |
| 47 | Ga0466697_002070 | 3300042611 | Bacteria | 1037 |
| 48 | Ga0466702_129722 | 3300042635 | Unclassified | 1810 |
| 49 | Ga0466725_156786 | 3300042654 | Bacteria | 6544 |
| 50 | JGI24698J34947_10280079 | 3300002449 | Bacteria | 610 |
| 51 | Ga0123357_10384813 | 3300009784 | Unclassified | 1297 |
| 52 | Ga0123357_10904798 | 3300009784 | Bacteria | 569 |
| 53 | Ga0123354_10134592 | 3300010882 | Unclassified | 3099 |
| 54 | Ga0123354_10190174 | 3300010882 | Unclassified | 2302 |
| 55 | Ga0123354_10365241 | 3300010882 | Unclassified | 1267 |
| 56 | Ga0466731_159560 | 3300042622 | Bacteria | 1946 |
| 57 | Ga0466702_297552 | 3300042635 | Unclassified | 1098 |
| 58 | Ga0466710_317240 | 3300042613 | Unclassified | 1896 |
| 59 | 2227502413 | 2225789004 | Bacteria | 19081 |
| 60 | IMNBL1DRAFT_c0082165 | 3300000062 | Unclassified | 901 |
| 61 | JGI24702J35022_10062630 | 3300002462 | Bacteria | 1992 |
| 62 | JGI24702J35022_10228586 | 3300002462 | Bacteria | 1075 |
| 63 | JGI24702J35022_10983747 | 3300002462 | Bacteria | 525 |
| 64 | Ga0123355_10163874 | 3300009826 | Bacteria | 3341 |
| 65 | Ga0123356_10399093 | 3300010049 | Bacteria | 1512 |
| 66 | Ga0123356_13786755 | 3300010049 | Unclassified | 522 |
| 67 | Ga0123353_10873837 | 3300010167 | Unclassified | 1228 |
| 68 | Ga0466657_239488 | 3300042582 | Bacteria | 3034 |
| 69 | Ga0466657_363572 | 3300042582 | Bacteria | 6720 |
| 70 | Ga0466693_379996 | 3300042592 | Unclassified | 1492 |
| 71 | Ga0466694_251512 | 3300042594 | Unclassified | 1533 |
| 72 | Ga0466699_436543 | 3300042597 | Bacteria | 1008 |
| 73 | Ga0466701_036384 | 3300042598 | Bacteria | 1331 |
| 74 | Ga0466707_229155 | 3300042601 | Bacteria | 2659 |
| 75 | Ga0466734_066928 | 3300042623 | Bacteria | 1921 |
| 76 | Ga0466734_078117 | 3300042623 | Bacteria | 1184 |
| 77 | Ga0466704_015153 | 3300042643 | Unclassified | 1871 |
| 78 | Ga0466705_056593 | 3300042612 | Bacteria | 4346 |
| 79 | 2227105802 | 2225789004 | Bacteria | 9509 |
| 80 | IMNBL1DRAFT_c0040440 | 3300000062 | Bacteria | 1578 |
| 81 | AustNasuHG_c1075343 | 3300000089 | Bacteria | 590 |
| 82 | JGI24702J35022_10002564 | 3300002462 | Bacteria | 11046 |
| 83 | Ga0123357_10043751 | 3300009784 | Bacteria | 6082 |
| 84 | Ga0123357_10442766 | 3300009784 | Bacteria | 1135 |
| 85 | Ga0123356_10096006 | 3300010049 | Bacteria | 2834 |
| 86 | Ga0123356_10109749 | 3300010049 | Bacteria | 2663 |
| 87 | Ga0123356_10170766 | 3300010049 | Bacteria | 2185 |
| 88 | Ga0123356_10603975 | 3300010049 | Unclassified | 1262 |
| 89 | Ga0123353_10068841 | 3300010167 | Bacteria | 5684 |
| 90 | Ga0160459_120178 | 3300012831 | Bacteria | 717 |
| 91 | Ga0466656_283362 | 3300042550 | Bacteria | 2759 |
| 92 | Ga0466699_389037 | 3300042597 | Bacteria | 1132 |
| 93 | Ga0466717_220604 | 3300042604 | Bacteria | 1487 |
| 94 | Ga0466716_142950 | 3300042605 | Bacteria | 3336 |
| 95 | Ga0466698_485584 | 3300042610 | Unclassified | 2140 |
| 96 | Ga0466731_020297 | 3300042622 | Bacteria | 1151 |
| 97 | Ga0105008_1100175 | 3300007507 | Bacteria | 3934 |
| 98 | Ga0123355_11919020 | 3300009826 | Unclassified | 553 |
| 99 | Ga0123356_10187953 | 3300010049 | Bacteria | 2094 |
| 100 | Ga0123353_10189312 | 3300010167 | Bacteria | 3250 |
| 101 | Ga0123353_10665465 | 3300010167 | Bacteria | 1470 |
| 102 | Ga0123354_10478091 | 3300010882 | Bacteria | 987 |
| 103 | Ga0123354_10771861 | 3300010882 | Bacteria | 654 |
| 104 | Ga0160433_100049 | 3300012846 | Bacteria | 134813 |
| 105 | Ga0466657_110573 | 3300042582 | Bacteria | 1096 |
| 106 | Ga0466731_292986 | 3300042622 | Bacteria | 2249 |
| 107 | Ga0466731_378174 | 3300042622 | Unclassified | 1293 |
| 108 | Ga0466734_003021 | 3300042623 | Bacteria | 1237 |
| 109 | Ga0466710_279750 | 3300042613 | Bacteria | 3438 |
| 110 | IMNBGM34_c003600 | 3300000036 | Bacteria | 2127 |
| 111 | IMNBL1DRAFT_c0002118 | 3300000062 | Bacteria | 14131 |
| 112 | Ga0123357_10284582 | 3300009784 | Unclassified | 1701 |
| 113 | Ga0123356_11400671 | 3300010049 | Bacteria | 859 |
| 114 | Ga0123356_12639489 | 3300010049 | Bacteria | 629 |
| 115 | Ga0123356_13616993 | 3300010049 | Unclassified | 535 |
| 116 | Ga0123353_11880207 | 3300010167 | Bacteria | 740 |
| 117 | Ga0160433_100211 | 3300012846 | Bacteria | 45566 |
| 118 | Ga0466656_034761 | 3300042550 | Bacteria | 1145 |
| 119 | Ga0466693_352888 | 3300042592 | Bacteria | 1017 |
| 120 | Ga0466694_177093 | 3300042594 | Bacteria | 2800 |
| 121 | Ga0466701_000462 | 3300042598 | Bacteria | 39838 |
| 122 | Ga0466701_008343 | 3300042598 | Bacteria | 1281 |
| 123 | Ga0466698_258463 | 3300042610 | Bacteria | 1806 |
| 124 | Ga0466734_017918 | 3300042623 | Bacteria | 6867 |
| 125 | Ga0466734_094736 | 3300042623 | Unclassified | 1230 |
| 126 | Ga0466734_119869 | 3300042623 | Bacteria | 2618 |
| 127 | Ga0466724_68678 | 3300042649 | Bacteria | 1171 |
| 128 | Ga0466725_083232 | 3300042654 | Unclassified | 1286 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.