Protein Family IF02797
Metagenome
Isolate
120
Members
52
Samples
107
Scaffolds
199.07
Avg Length
Representative Sequence
- ID
- 3300010049|Ga0123356_10097386|Ga0123356_100973863
- Length
- 229 aa
- Sequence
- LKELAASGRLRMFRAAADSFSAIERKYYLMDQPIAPLAQLAEQFGRLPGIGRKSAQRLAYFMLNLPEEEAKAFAETILSARLNVRRCALCCDLTDGDLCAVCRSANRDGSVICVVEDPRDVMAVERTHEFRGLYHVLHGVISPLNGVGPEHLSVKELLRRFEDGLVREVIMATNPTVEGEATAMYLSRLLKPLGLRVTRLAYGVPVGADLEYADEVTLSRALEGRREI*
Sample Types
Isolate
10.8%
Metagenome
89.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
37.3%
Unclassified
27.5%
Kalotermitidae
21.6%
Rhinotermitidae
5.9%
Termopsidae
3.9%
Hodotermitidae
2.0%
Passalidae
2.0%
Taxonomy
Archaea
0
Bacteria
112
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820240463 | Unclassified Firmicutes Th196P3bin85 | Isolate | Unclassified |
| 2 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 3 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 4 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 5 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 6 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 7 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 8 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 9 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 10 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 11 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 12 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 13 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 14 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 15 | 2820075487 | Unclassified Proteobacteria Nt197P3bin122 | Isolate | Unclassified |
| 16 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 17 | 2820046858 | Unclassified Proteobacteria Th196P3bin84 | Isolate | Unclassified |
| 18 | 2820367663 | Unclassified Firmicutes Nt197P3bin105 | Isolate | Unclassified |
| 19 | 2820584674 | Unclassified Firmicutes Emb289P1bin98 | Isolate | Unclassified |
| 20 | 2820316744 | Unclassified Firmicutes Nt197P3bin99 | Isolate | Unclassified |
| 21 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 22 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 23 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 24 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 25 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 26 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 27 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 28 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 29 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 30 | 2820657860 | Unclassified Firmicutes Co191P4bin15 | Isolate | Unclassified |
| 31 | 2820711732 | Unclassified Firmicutes Co191P1bin26 | Isolate | Unclassified |
| 32 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 33 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 34 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 35 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 36 | 2820429680 | Unclassified Firmicutes Lab288P3bin30 | Isolate | Unclassified |
| 37 | 2820688768 | Unclassified Firmicutes Co191P1bin74 | Isolate | Unclassified |
| 38 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 39 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 40 | 2820406809 | Unclassified Firmicutes Lab288P4bin87 | Isolate | Unclassified |
| 41 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 42 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 43 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 44 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 45 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 46 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 47 | 2820474468 | Unclassified Firmicutes Lab288P1bin84 | Isolate | Unclassified |
| 48 | 2820504582 | Unclassified Firmicutes Lab288P1bin5 | Isolate | Unclassified |
| 49 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 50 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 51 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 52 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466692_127384 | 3300042591 | Bacteria | 123881 |
| 2 | Ga0123357_10482762 | 3300009784 | Bacteria | 1045 |
| 3 | Ga0123355_10000077 | 3300009826 | Bacteria | 104090 |
| 4 | Ga0123355_10004208 | 3300009826 | Bacteria | 20907 |
| 5 | Ga0123355_10083270 | 3300009826 | Bacteria | 5099 |
| 6 | Ga0123356_10372071 | 3300010049 | Bacteria | 1559 |
| 7 | Ga0123356_11216790 | 3300010049 | Bacteria | 919 |
| 8 | Ga0123353_10000328 | 3300010167 | Bacteria | 58613 |
| 9 | Ga0123353_10006815 | 3300010167 | Bacteria | 15323 |
| 10 | Ga0123353_10542910 | 3300010167 | Bacteria | 1679 |
| 11 | Ga0123353_10976559 | 3300010167 | Unclassified | 1142 |
| 12 | Ga0123353_11232143 | 3300010167 | Bacteria | 978 |
| 13 | Ga0466722_213463 | 3300042609 | Bacteria | 3030 |
| 14 | 2227551575 | 2225789004 | Bacteria | 2841 |
| 15 | JGI24696J40584_12956867 | 3300002834 | Bacteria | 3266 |
| 16 | Ga0072941_1185902 | 3300005201 | Bacteria | 2829 |
| 17 | Ga0466718_152018 | 3300042617 | Bacteria | 8884 |
| 18 | Ga0466703_251859 | 3300042636 | Bacteria | 12529 |
| 19 | Ga0466690_205631 | 3300042590 | Bacteria | 15893 |
| 20 | Ga0123356_10006990 | 3300010049 | Bacteria | 11329 |
| 21 | Ga0123356_10097386 | 3300010049 | Bacteria | 2815 |
| 22 | Ga0123356_10302644 | 3300010049 | Unclassified | 1705 |
| 23 | Ga0123356_10361612 | 3300010049 | Bacteria | 1578 |
| 24 | Ga0123356_10632360 | 3300010049 | Bacteria | 1236 |
| 25 | Ga0123356_11062685 | 3300010049 | Bacteria | 979 |
| 26 | Ga0123356_11537180 | 3300010049 | Bacteria | 822 |
| 27 | Ga0123353_10019623 | 3300010167 | Bacteria | 10056 |
| 28 | Ga0123353_10089509 | 3300010167 | Bacteria | 4956 |
| 29 | JGI24702J35022_10008347 | 3300002462 | Bacteria | 5865 |
| 30 | Ga0466697_171562 | 3300042611 | Bacteria | 1646 |
| 31 | Ga0466709_098591 | 3300042648 | Bacteria | 1179 |
| 32 | Ga0123355_10468542 | 3300009826 | Bacteria | 1576 |
| 33 | Ga0123355_10547490 | 3300009826 | Bacteria | 1401 |
| 34 | Ga0123356_10338412 | 3300010049 | Bacteria | 1624 |
| 35 | Ga0123353_10016584 | 3300010167 | Bacteria | 10775 |
| 36 | Ga0123353_10035510 | 3300010167 | Bacteria | 7795 |
| 37 | Ga0123354_10482203 | 3300010882 | Bacteria | 980 |
| 38 | Ga0466717_006918 | 3300042604 | Bacteria | 2569 |
| 39 | Ga0466722_125364 | 3300042609 | Bacteria | 7492 |
| 40 | Ga0466715_429206 | 3300042616 | Bacteria | 39560 |
| 41 | Ga0466718_013671 | 3300042617 | Bacteria | 1009 |
| 42 | Ga0466702_089496 | 3300042635 | Bacteria | 3463 |
| 43 | Ga0466708_421862 | 3300042652 | Bacteria | 102077 |
| 44 | Ga0466693_194591 | 3300042592 | Bacteria | 2128 |
| 45 | Ga0466699_275974 | 3300042597 | Bacteria | 1288 |
| 46 | Ga0123356_11860610 | 3300010049 | Bacteria | 749 |
| 47 | Ga0123353_10071302 | 3300010167 | Bacteria | 5582 |
| 48 | Ga0123353_11427360 | 3300010167 | Unclassified | 887 |
| 49 | Ga0466719_489138 | 3300042606 | Bacteria | 1369 |
| 50 | Ga0466722_161053 | 3300042609 | Bacteria | 58719 |
| 51 | Ga0466726_416229 | 3300042619 | Bacteria | 8813 |
| 52 | Ga0466729_177237 | 3300042621 | Bacteria | 4739 |
| 53 | Ga0466735_141611 | 3300042624 | Bacteria | 2125 |
| 54 | Ga0466732_406817 | 3300042656 | Bacteria | 3223 |
| 55 | Ga0466733_142763 | 3300042659 | Bacteria | 1204 |
| 56 | Ga0466733_176714 | 3300042659 | Bacteria | 10507 |
| 57 | Ga0123357_10185723 | 3300009784 | Bacteria | 2412 |
| 58 | Ga0123355_10088742 | 3300009826 | Bacteria | 4910 |
| 59 | Ga0123355_11248746 | 3300009826 | Bacteria | 752 |
| 60 | Ga0123353_10000076 | 3300010167 | Bacteria | 108569 |
| 61 | Ga0123353_10461411 | 3300010167 | Bacteria | 1866 |
| 62 | Ga0123353_10651191 | 3300010167 | Bacteria | 1491 |
| 63 | Ga0466706_071576 | 3300042599 | Bacteria | 1031 |
| 64 | Ga0466716_245016 | 3300042605 | Bacteria | 3247 |
| 65 | Ga0466719_453740 | 3300042606 | Bacteria | 2934 |
| 66 | Ga0466722_157638 | 3300042609 | Bacteria | 26308 |
| 67 | JGI24702J35022_10024237 | 3300002462 | Bacteria | 3279 |
| 68 | JGI24702J35022_10110518 | 3300002462 | Bacteria | 1511 |
| 69 | JGI24703J35330_11315053 | 3300002501 | Unclassified | 863 |
| 70 | JGI24696J40584_12934539 | 3300002834 | Bacteria | 1541 |
| 71 | Ga0466729_305523 | 3300042621 | Bacteria | 3481 |
| 72 | Ga0466733_066207 | 3300042659 | Bacteria | 1612 |
| 73 | Ga0466733_115109 | 3300042659 | Bacteria | 1718 |
| 74 | Ga0466733_147917 | 3300042659 | Bacteria | 1212 |
| 75 | Ga0123356_10269053 | 3300010049 | Unclassified | 1793 |
| 76 | Ga0123356_10906417 | 3300010049 | Bacteria | 1053 |
| 77 | Ga0123356_11323080 | 3300010049 | Bacteria | 883 |
| 78 | Ga0123353_10001816 | 3300010167 | Bacteria | 26262 |
| 79 | Ga0123353_10004886 | 3300010167 | Bacteria | 17428 |
| 80 | Ga0123353_10188677 | 3300010167 | Bacteria | 3256 |
| 81 | Ga0123353_10243425 | 3300010167 | Bacteria | 2792 |
| 82 | Ga0466716_366992 | 3300042605 | Bacteria | 7041 |
| 83 | JGI24695J34938_10093017 | 3300002450 | Unclassified | 1236 |
| 84 | JGI24702J35022_10010942 | 3300002462 | Bacteria | 5063 |
| 85 | Ga0466711_226661 | 3300042615 | Bacteria | 9172 |
| 86 | Ga0466697_221566 | 3300042611 | Bacteria | 2330 |
| 87 | Ga0466704_419212 | 3300042643 | Bacteria | 74407 |
| 88 | Ga0466656_387793 | 3300042550 | Bacteria | 1706 |
| 89 | Ga0466696_411856 | 3300042596 | Bacteria | 6294 |
| 90 | Ga0123356_10637413 | 3300010049 | Bacteria | 1232 |
| 91 | Ga0123353_10020009 | 3300010167 | Bacteria | 9976 |
| 92 | Ga0123353_10020869 | 3300010167 | Bacteria | 9805 |
| 93 | Ga0466706_283584 | 3300042599 | Unclassified | 1373 |
| 94 | Ga0466722_047899 | 3300042609 | Bacteria | 99541 |
| 95 | Ga0466703_274772 | 3300042636 | Bacteria | 7065 |
| 96 | Ga0466733_032042 | 3300042659 | Unclassified | 1351 |
| 97 | Ga0466733_216249 | 3300042659 | Bacteria | 1406 |
| 98 | Ga0123353_10004045 | 3300010167 | Bacteria | 18793 |
| 99 | Ga0123353_10705433 | 3300010167 | Bacteria | 1415 |
| 100 | Ga0123353_10716552 | 3300010167 | Bacteria | 1401 |
| 101 | Ga0123353_10981447 | 3300010167 | Bacteria | 1138 |
| 102 | Ga0466707_168645 | 3300042601 | Bacteria | 20465 |
| 103 | Ga0466719_548094 | 3300042606 | Bacteria | 20823 |
| 104 | Ga0466711_043133 | 3300042615 | Bacteria | 8516 |
| 105 | Ga0466705_304485 | 3300042612 | Bacteria | 3435 |
| 106 | Ga0466734_109397 | 3300042623 | Bacteria | 1240 |
| 107 | Ga0466703_347772 | 3300042636 | Bacteria | 4036 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.